DC900376

Overview
NameDC900376
Unique NameDC900376
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length744
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900376_ssr9 microsatellite DC900376_ssr9:9..30. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig4376 contig Csv1_Contig4376:165..904. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_CANAL (Translationally-controlled tumor protein homolog OS=Candida albicans GN=TMA19 PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.453e-19
Identity = 60/170 (35.29%), Postives = 90/170 (52.94%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            ML+++D+++GDELLSD++  K ++ G ++E +   V  G  D+DIGANPS                V ++V +FRLQ    FDKK F TY+K ++K +   L+E   +  E F+K      K +L    D +F+ GESM  D  +V   Y+E  T P        +KE K
Sbjct:    1 MLIFEDVISGDELLSDAYDVKLVD-GAVYEADCAMVTVGNGDIDIGANPSAEDGEEALEDGAET--VNNVVYSFRLQPT-MFDKKSFTTYIKGYMKRIKAYLAENDPDSVEAFEKGATAYVKKVLGSFKDWEFYTGESMDPDAMVVLLNYREDGTTPYVAIWKHGVKENK 166          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_PIG (Translationally-controlled tumor protein OS=Sus scrofa GN=TPT1 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 7.121e-19
Identity = 59/174 (33.91%), Postives = 92/174 (52.87%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVD---IGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGAT---KFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            M++Y+DL++ DE+ SD +  +EI +G+  EVEGK V +   ++D   IG N S                V DIV    LQE  +F K+ +  Y+K ++K +  KL E+R E  K  + GA    K +L+   + QFF+GE+M+ DG +    Y+E    P  ++  D L+  KC
Sbjct:    1 MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGV-DIVMNHHLQET-SFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 172          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_PANTR (Translationally-controlled tumor protein OS=Pan troglodytes GN=TPT1 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 7.121e-19
Identity = 59/174 (33.91%), Postives = 92/174 (52.87%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVD---IGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGAT---KFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            M++Y+DL++ DE+ SD +  +EI +G+  EVEGK V +   ++D   IG N S                V DIV    LQE  +F K+ +  Y+K ++K +  KL E+R E  K  + GA    K +L+   + QFF+GE+M+ DG +    Y+E    P  ++  D L+  KC
Sbjct:    1 MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGV-DIVMNHHLQET-SFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 172          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_HUMAN (Translationally-controlled tumor protein OS=Homo sapiens GN=TPT1 PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 7.121e-19
Identity = 59/174 (33.91%), Postives = 92/174 (52.87%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVD---IGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGAT---KFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            M++Y+DL++ DE+ SD +  +EI +G+  EVEGK V +   ++D   IG N S                V DIV    LQE  +F K+ +  Y+K ++K +  KL E+R E  K  + GA    K +L+   + QFF+GE+M+ DG +    Y+E    P  ++  D L+  KC
Sbjct:    1 MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGV-DIVMNHHLQET-SFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 172          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_BOVIN (Translationally-controlled tumor protein OS=Bos taurus GN=TPT1 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 9.301e-19
Identity = 58/174 (33.33%), Postives = 92/174 (52.87%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVD---IGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGAT---KFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            M++Y+DL++ DE+ SD +  +E+ +G+  EVEGK V +   ++D   IG N S                V DIV    LQE  +F K+ +  Y+K ++K +  KL E+R E  K  + GA    K +L+   + QFF+GE+M+ DG +    Y+E    P  ++  D L+  KC
Sbjct:    1 MIIYRDLISHDEMFSDIYKIREVADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGV-DIVMNHHLQET-SFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 172          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_BOMMO (Translationally-controlled tumor protein homolog OS=Bombyx mori GN=Tctp PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 9.301e-19
Identity = 61/174 (35.06%), Postives = 93/174 (53.45%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAF-DKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYK--EGATDPTFLYMADALKEVK 586
            M +Y+D++TGDE+ SD++  K ++  +++EV G+ V +   D+ I G NPS                 VDIV   RL E  AF DKK +  Y+K ++K L  KL E   ++ E+FK N+    K +L +  +LQFF GESM  DG +    Y+  +G   P  ++    L+E K
Sbjct:    1 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVTRAQGDIQIEGFNPSAEEADEGTDSAVESG--VDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQFFTGESMDCDGMVAMMEYRDFDGTQIPIMMFFKHGLEEEK 171          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_RABIT (Translationally-controlled tumor protein OS=Oryctolagus cuniculus GN=TPT1 PE=2 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 2.072e-18
Identity = 58/174 (33.33%), Postives = 91/174 (52.30%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVD---IGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGAT---KFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            M++Y+DL++ DE+ SD +  +EI  G+  EVEGK V +   ++D   IG N S                V DIV    LQE  +F K+ +  Y+K ++K +  KL E+R E  K  + GA    K +L+   + QF++GE+M+ DG +    Y+E    P  ++  D L+  KC
Sbjct:    1 MIIYRDLISHDEMFSDIYKIREIAGGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGV-DIVMNHHLQET-SFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFYIGENMNPDGMVALLDYREDGVTPFMIFFKDGLEMEKC 172          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_DEBHA (Translationally-controlled tumor protein homolog OS=Debaryomyces hansenii GN=DEHA2E17468g PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.072e-18
Identity = 57/157 (36.31%), Postives = 89/157 (56.69%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKF---LLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDP 547
            M+++ D+++GDELLSD++  K +++ +++E +   V     DVDIGANPS                V ++V +FRLQ Q +FDKK F+TYMK ++K +   L+E+  E  +    GA  +   ++S   D  F+ GESM  DG +V   Y+E  T P
Sbjct:    1 MIIFTDVISGDELLSDAYDVKLVDD-VVYEADCAMVNVNNGDVDIGANPSAEEGGEDLEDGTET--VNNVVYSFRLQ-QTSFDKKSFMTYMKGYMKRVKAHLAEKNPEAIEAFENGAKTYFKKVVSSFGDWDFYTGESMDPDGMVVLLNYREDGTTP 153          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_XENTR (Translationally-controlled tumor protein homolog OS=Xenopus tropicalis GN=tpt1 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.616e-18
Identity = 55/173 (31.79%), Postives = 86/173 (49.71%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWV--VQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            M++Y+D +T DE+ SD +   E  +G+ +EVEGK +  V+GA+D  +    +                 VDIV   +LQE   F K  +  Y+K ++KL+  KL E   +R + F K I+   K +L    + QF+ GE M+ DG +    Y+E    P  ++  D L   KC
Sbjct:    1 MIIYKDTVTEDEMFSDIYKIAETPDGMCFEVEGKIIQRVEGAIDDALIGGNASAECQEEDIGGATTVSGVDIVINHKLQET-GFTKDSYKNYIKDYVKLVKAKLEETDPDRVKPFMKGIQDRVKLILGNFKNYQFYTGERMNPDGMVALLDYREDGVTPFMIFFKDGLISEKC 172          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_LONON (Translationally-controlled tumor protein homolog OS=Lonomia obliqua GN=Tctp PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.873e-18
Identity = 62/175 (35.43%), Postives = 94/175 (53.71%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWV--VQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAF-DKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYK--EGATDPTFLYMADALKEVK 586
            M +Y+D++TGDE+ SD++  K ++  +++EV GK V   QG + +D G NPS                 VDIV   RL E  AF DKK +  Y+K ++K L  KL E   ++ +IFK N+    K +L++  +LQFF GESM  DG +    Y+  +    P  ++    L+E K
Sbjct:    1 MRIYKDIITGDEMFSDTYKVKLVDE-VIYEVTGKLVSRTQGDIQID-GFNPSAEEADEGTDSNVETG--VDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVDIFKTNMNKVMKDILARFKELQFFTGESMDCDGMVAMMEYRKVDETEIPIMMFFKHGLEEEK 171          
The following BLAST results are available for this feature:
BLAST of DC900376 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
TCTP_CANAL5.453e-1935.29Translationally-controlled tumor protein homolog O... [more]
TCTP_PIG7.121e-1933.91Translationally-controlled tumor protein OS=Sus sc... [more]
TCTP_PANTR7.121e-1933.91Translationally-controlled tumor protein OS=Pan tr... [more]
TCTP_HUMAN7.121e-1933.91Translationally-controlled tumor protein OS=Homo s... [more]
TCTP_BOVIN9.301e-1933.33Translationally-controlled tumor protein OS=Bos ta... [more]
TCTP_BOMMO9.301e-1935.06Translationally-controlled tumor protein homolog O... [more]
TCTP_RABIT2.072e-1833.33Translationally-controlled tumor protein OS=Orycto... [more]
TCTP_DEBHA2.072e-1836.31Translationally-controlled tumor protein homolog O... [more]
TCTP_XENTR4.616e-1831.79Translationally-controlled tumor protein homolog O... [more]
TCTP_LONON7.873e-1835.43Translationally-controlled tumor protein homolog O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900376 VSS Citrus sinensis cDNA clone VS28946 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900376 ID=DC900376|Name=DC900376|organism=Citrus sinensis|type=EST|length=744bp
CCGCTGCGTCTCTCTCTCTCTCTCTCTCTCCAGTTTTCTCCGTTGATTAT
TTTTCTTTTTTGTGTTCGCGAGAGAGACTGCAATCATGTTGGTCTATCAA
GATCTCCTCACCGGTGATGAGCTTCTCTCCGATTCTTTTCCCTACAAGGA
AATTGAGAATGGGATTCTGTGGGAAGTTGAGGGAAAGTGGGTTGTACAAG
GAGCCGTTGATGTTGACATTGGTGCAAATCCTTCTGCCGAAGGAGCTGAT
GAGGATGAGGGTGTTGATGACCAAGCCGTGAAGGTGGTTGACATTGTCGA
CACATTCAGGCTACAGGAGCAACCCGCTTTTGACAAGAAGCCGTTTGTAA
CATACATGAAGAGATTCATCAAGTTGCTGACGCCCAAGCTGAGTGAGGAG
AGGCAGGAGATATTTAAGAAGAATATTGAGGGAGCGACCAAGTTCTTGCT
CTCGAAGCTCAGTGACCTTCAATTCTTTGTTGGGGAGAGCATGCATGATG
ATGGCTGTCTTGTCTTTGCTTACTACAAGGAAGGTGCGACCGACCCAACA
TTTTTGTATATGGCTGATGCATTGAAGGAGGTGAAGTGCTAAGCTGGGCT
TCGAAGAGGAAGTGCCTGCTGTAGTTCTAATTTTAATTATTGCCCGCGGT
TATTTTTATGTATCTTTTGTGCTGGTTTACTCGGGACTTGTGCTTGCTGT
TTTTTAGTTTTTATTTTGACATAAACAATATGTTTTTCTGCTCT
back to top