CX043796

Overview
NameCX043796
Unique NameCX043796
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length729
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig892 contig Csv1_Contig892:117..845. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_SYNE7 (60 kDa chaperonin OS=Synechococcus elongatus (strain PCC 7942) GN=groL PE=3 SV=2)

HSP 1 Score: 202.986 bits (515), Expect = 1.379e-51
Identity = 102/176 (57.95%), Postives = 138/176 (78.41%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIE 720
            AK I +++ +R A++ GID L++AV +TLGP+GRNVVL++ FG+P+++NDGVTIA+ IEL D +EN G ALIR+ ASKTND+AGDGTTTA+VLA  ++K GL +V +GAN + LKRGIDK  + LVE+++  ARP+E    I  V  ISAGND  +G MIADA+DKVG +GV+S+E
Sbjct:    2 AKRIIYNENARRALEKGIDILAEAVAVTLGPKGRNVVLEKKFGAPQIINDGVTIAKEIELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAVVKEGLRNVAAGANAILLKRGIDKATNFLVEQIKSHARPVEDSKSIAQVGAISAGNDFEVGQMIADAMDKVGKEGVISLE 177          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_GEMAT (60 kDa chaperonin OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=groL PE=3 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.379e-51
Identity = 99/179 (55.31%), Postives = 146/179 (81.56%), Query Frame = 1
Query:  193 SAKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            +AK++ F+  +RAA++ G+D+L++AV +TLGP+GRNVV+D+ FG+P V  DGVT+A+ IELADP+EN GA +++EVA+KT+D AGDGTTTA+VLA+ I + GL +VT+G+NP++LKRGI+K V G+VEEL++ + P  G+ +I  V TISA ND  IG +IA+A++KVG DGV+++E +
Sbjct:    2 AAKELHFNVDARAALKRGVDQLAEAVKVTLGPKGRNVVIDKKFGAPTVTKDGVTVAKEIELADPIENMGAQMVKEVATKTSDLAGDGTTTATVLAQAIFREGLKNVTAGSNPMALKRGIEKAVAGIVEELKRISVPTTGKKEIAQVGTISANNDPEIGNLIAEAMEKVGKDGVITVEEA 180          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH601_SYNP6 (60 kDa chaperonin 1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=groL1 PE=3 SV=2)

HSP 1 Score: 202.986 bits (515), Expect = 1.379e-51
Identity = 102/176 (57.95%), Postives = 138/176 (78.41%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIE 720
            AK I +++ +R A++ GID L++AV +TLGP+GRNVVL++ FG+P+++NDGVTIA+ IEL D +EN G ALIR+ ASKTND+AGDGTTTA+VLA  ++K GL +V +GAN + LKRGIDK  + LVE+++  ARP+E    I  V  ISAGND  +G MIADA+DKVG +GV+S+E
Sbjct:    2 AKRIIYNENARRALEKGIDILAEAVAVTLGPKGRNVVLEKKFGAPQIINDGVTIAKEIELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAVVKEGLRNVAAGANAILLKRGIDKATNFLVEQIKSHARPVEDSKSIAQVGAISAGNDFEVGQMIADAMDKVGKEGVISLE 177          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_PELPB (60 kDa chaperonin OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=groL PE=3 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.801e-51
Identity = 101/179 (56.42%), Postives = 138/179 (77.09%), Query Frame = 1
Query:  193 SAKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            +AKDI FD  +RA ++ G+DKL++AV +TLGP GRNV++D+ FG+P    DGVT+A+ IEL+DP EN GA ++REVASKT+D AGDGTTTA+VLA+ I + GL +V +GA P+ LKRGID+ V  +V+EL   +R I G+ +I  V TISA ND +IG +IADA+DKVG DGV+++E +
Sbjct:    2 TAKDILFDSDARAKLKVGVDKLANAVKVTLGPAGRNVLIDKKFGAPTSTKDGVTVAKEIELSDPFENMGAQMVREVASKTSDVAGDGTTTATVLAQAIYREGLKNVAAGARPIDLKRGIDRAVKEVVQELRNISRSISGKKEIAQVGTISANNDPVIGDLIADAMDKVGKDGVITVEEA 180          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_HALOH (60 kDa chaperonin OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=groL PE=3 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 2.352e-51
Identity = 99/178 (55.62%), Postives = 142/178 (79.78%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AK++ F + +R A++ G+D L++AV +TLGP+GRNVVL++ FG+P + NDGV+IAR IEL +  EN GA  ++EVA+KTND AGDGTTTA+VLA+ I K GL +V +GANP+ LKRGI+K V  LVEE+++ ++P+EG++ +  VA ISAGND+ +G +IA+A++KVG DGV+S+E S
Sbjct:    2 AKELKFSEDARRALERGVDTLANAVKVTLGPKGRNVVLEKSFGAPTITNDGVSIAREIELENHYENMGAQTVKEVATKTNDVAGDGTTTATVLAQAIFKEGLKNVAAGANPMILKRGIEKAVQKLVEEIKELSKPVEGKEAVSQVAAISAGNDEEVGKLIAEAMEKVGQDGVISVEES 179          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_DESHY (60 kDa chaperonin OS=Desulfitobacterium hafniense (strain Y51) GN=groL PE=3 SV=2)

HSP 1 Score: 202.216 bits (513), Expect = 2.352e-51
Identity = 100/178 (56.18%), Postives = 143/178 (80.34%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AK I F++ +R A++ G++ L+++V +TLGP+GRNVVLD+ FG+P + NDGVTIAR IEL DP EN GA L++EVA+KTND AGDGTTTA+VLA+ II+ GL +V +GANP+ +KRGI+K V  +V++++  A+PIE ++ I  VA+ISAG DD IG +I+DA++KVG DGV+++E +
Sbjct:    2 AKQIVFNEEARRALERGVNALAESVRVTLGPKGRNVVLDKKFGAPLITNDGVTIAREIELEDPFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAIIREGLKNVAAGANPMGIKRGIEKAVESVVDDIKTNAKPIESKESIAQVASISAG-DDNIGVLISDAMEKVGKDGVITVEEA 178          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_ANOFW (60 kDa chaperonin OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=groL PE=3 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 3.072e-51
Identity = 104/178 (58.43%), Postives = 141/178 (79.21%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AK+I F + +R AM  G+DKL+DAV +TLGP+GRNVVL++ FGSP + NDGVTIA+ IEL DP EN GA L+ EVASKTND AGDGTTTA+VLA+ +I+ GL +VT+GANP+ +++GI+K V   VEEL+  ++PIEG+D I  VA ISA  D+ +G +IA+A+++VG DGV+++E S
Sbjct:    2 AKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIEKAVAVAVEELKAISKPIEGKDSIAQVAAISAA-DEEVGQLIAEAMERVGKDGVITLEES 178          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_CALS8 (60 kDa chaperonin OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903) GN=groL PE=3 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 4.012e-51
Identity = 101/179 (56.42%), Postives = 145/179 (81.01%), Query Frame = 1
Query:  193 SAKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            +AK I FD+ +R A++ G++KL+D V +TLGP+GRNVVL++ FGSP++VNDGVTIA+ IEL DP EN GA ++REVASKTND AGDGTTTA+VLA+ +I+ GL ++ +GANP+ L+RGI K V  +V+E++K ++ + G++DI  VA+ISAG D+ IG ++ADA++KV  DGV+++E S
Sbjct:    2 AAKMILFDEEARRALERGVNKLADTVKVTLGPKGRNVVLEKKFGSPQIVNDGVTIAKEIELEDPFENMGAQIVREVASKTNDIAGDGTTTATVLAQAMIREGLKNIAAGANPMILRRGIQKAVDVVVDEIKKMSKKVRGKEDITYVASISAG-DEEIGKLVADAMEKVTNDGVITVEES 179          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_DICTD (60 kDa chaperonin OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=groL PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 5.240e-51
Identity = 100/179 (55.87%), Postives = 139/179 (77.65%), Query Frame = 1
Query:  193 SAKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            +AK ++ D  +R A+  G+D ++D V +TLGP+GRNVVL++ FG+P + NDGVTIA+ I+L DP EN GA L++EVASKTND AGDGTTTA+VLA+ ++  G+  V +GANP+ +KRGI+K V  +VEEL+K A+P+E + DI  VA ISA ND+ IG +IA+A+DKVG DGV+++E S
Sbjct:    2 AAKLVSLDMQARTALIKGLDTVADTVKITLGPKGRNVVLEKKFGAPVITNDGVTIAKEIDLEDPFENMGAQLVKEVASKTNDVAGDGTTTATVLAQALVHEGMKHVVAGANPMYVKRGIEKAVEKVVEELKKIAKPVETKQDIAHVAAISANNDEEIGNLIAEAMDKVGKDGVITVEES 180          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_CLOBM (60 kDa chaperonin OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=groL PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 5.240e-51
Identity = 100/178 (56.18%), Postives = 141/178 (79.21%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AK + F + +R +M+AG+DKL+D V +TLGP+GRNVVLD+ FGSP + NDGVTIAR IEL DP EN GA L++EVA+KTND AGDGTTTA++LA+ II+ GL +VT+GANP+ ++ GI K V   VEE++  ++P+ G++DI  VA ISA +++ +G +IADA+++VG DGV+++E S
Sbjct:    2 AKSLLFGEQARRSMEAGVDKLADTVRVTLGPKGRNVVLDKKFGSPLITNDGVTIAREIELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVTAGANPIQIRTGIRKAVEKAVEEIKVISKPVNGKEDIARVAAISAASEE-VGKLIADAMERVGNDGVITVEES 178          
The following BLAST results are available for this feature:
BLAST of CX043796 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_SYNE71.379e-5157.9560 kDa chaperonin OS=Synechococcus elongatus (stra... [more]
CH60_GEMAT1.379e-5155.3160 kDa chaperonin OS=Gemmatimonas aurantiaca (stra... [more]
CH601_SYNP61.379e-5157.9560 kDa chaperonin 1 OS=Synechococcus sp. (strain A... [more]
CH60_PELPB1.801e-5156.4260 kDa chaperonin OS=Pelodictyon phaeoclathratifor... [more]
CH60_HALOH2.352e-5155.6260 kDa chaperonin OS=Halothermothrix orenii (strai... [more]
CH60_DESHY2.352e-5156.1860 kDa chaperonin OS=Desulfitobacterium hafniense ... [more]
CH60_ANOFW3.072e-5158.4360 kDa chaperonin OS=Anoxybacillus flavithermus (s... [more]
CH60_CALS84.012e-5156.4260 kDa chaperonin OS=Caldicellulosiruptor saccharo... [more]
CH60_DICTD5.240e-5155.8760 kDa chaperonin OS=Dictyoglomus turgidum (strain... [more]
CH60_CLOBM5.240e-5156.1860 kDa chaperonin OS=Clostridium botulinum (strain... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_13D12_g Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-13D12-H23-1-7.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043796 ID=CX043796; Name=CX043796; organism=Citrus sinensis; type=EST; length=729bp
GTTGGTACCTTATCCGAAACAATTTCCCTCAGCAGACGCTTTACTCCGTT
TGGTTGATTGTTCGAAATGGCTTCTGCTAACGCCCTTTCTTCGGCTTCCA
TTCTTTGCTCTCCCAAACAGGGGAGCTTGAGGAGGAGAGGAAATCAGAAT
CAGGGTCAGAGAGTAAATTACAGGAGATTCGCTGTTAGAGCGTCTGCCAA
AGATATTGCTTTTGACCAGATCTCCAGGGCCGCAATGCAGGCCGGCATCG
ATAAGCTTTCCGATGCTGTTGGCCTTACTCTGGGTCCAAGAGGGAGAAAT
GTTGTTCTGGATGAATTTGGAAGTCCGAAAGTGGTTAATGATGGAGTAAC
AATAGCCCGAGCTATTGAGCTCGCAGATCCCATGGAAAATGCTGGTGCTG
CTCTTATTAGGGAGGTTGCAAGCAAAACCAATGACTCTGCTGGTGATGGA
ACAACAACTGCATCAGTTCTTGCACGAGAAATAATCAAACTAGGACTCCT
GAGTGTCACGTCTGGTGCAAATCCTGTCTCCTTGAAGAGAGGGATTGATA
AAACTGTACATGGGTTGGTAGAAGAGTTGGAGAAGAGGGCCAGGCCTATC
GAAGGTCGTGATGATATCAAAGCTGTTGCTACCATCTCTGCTGGGAATGA
TGACCTGATTGGGACAATGATCGCCGATGCAATTGACAAGGTTGGTCCTG
ATGGCGTCTTGTCAATCGAGTCATCATCA
back to top