CX043796

Overview
NameCX043796
Unique NameCX043796
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length729
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig892 contig Csv1_Contig892:117..845. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_CLOBL (60 kDa chaperonin OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=groL PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 5.240e-51
Identity = 100/178 (56.18%), Postives = 141/178 (79.21%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AK + F + +R +M+AG+DKL+D V +TLGP+GRNVVLD+ FGSP + NDGVTIAR IEL DP EN GA L++EVA+KTND AGDGTTTA++LA+ II+ GL +VT+GANP+ ++ GI K V   VEE++  ++P+ G++DI  VA ISA +++ +G +IADA+++VG DGV+++E S
Sbjct:    2 AKSLLFGEQARRSMEAGVDKLADTVRVTLGPKGRNVVLDKKFGSPLITNDGVTIAREIELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVTAGANPIQIRTGIRKAVEKAVEEIKVISKPVNGKEDIARVAAISAASEE-VGKLIADAMERVGNDGVITVEES 178          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_CLOBK (60 kDa chaperonin OS=Clostridium botulinum (strain Okra / Type B1) GN=groL PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 5.240e-51
Identity = 100/178 (56.18%), Postives = 141/178 (79.21%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AK + F + +R +M+AG+DKL+D V +TLGP+GRNVVLD+ FGSP + NDGVTIAR IEL DP EN GA L++EVA+KTND AGDGTTTA++LA+ II+ GL +VT+GANP+ ++ GI K V   VEE++  ++P+ G++DI  VA ISA +++ +G +IADA+++VG DGV+++E S
Sbjct:    2 AKSLLFGEQARRSMEAGVDKLADTVRVTLGPKGRNVVLDKKFGSPLITNDGVTIAREIELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVTAGANPIQIRTGIRKAVEKAVEEIKVISKPVNGKEDIARVAAISAASEE-VGKLIADAMERVGNDGVITVEES 178          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_CLOBJ (60 kDa chaperonin OS=Clostridium botulinum (strain Kyoto / Type A2) GN=groL PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 5.240e-51
Identity = 100/178 (56.18%), Postives = 141/178 (79.21%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AK + F + +R +M+AG+DKL+D V +TLGP+GRNVVLD+ FGSP + NDGVTIAR IEL DP EN GA L++EVA+KTND AGDGTTTA++LA+ II+ GL +VT+GANP+ ++ GI K V   VEE++  ++P+ G++DI  VA ISA +++ +G +IADA+++VG DGV+++E S
Sbjct:    2 AKSLLFGEQARRSMEAGVDKLADTVRVTLGPKGRNVVLDKKFGSPLITNDGVTIAREIELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVTAGANPIQIRTGIRKAVEKAVEEIKVISKPVNGKEDIARVAAISAASEE-VGKLIADAMERVGNDGVITVEES 178          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_CLOBH (60 kDa chaperonin OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=groL PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 5.240e-51
Identity = 100/178 (56.18%), Postives = 141/178 (79.21%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AK + F + +R +M+AG+DKL+D V +TLGP+GRNVVLD+ FGSP + NDGVTIAR IEL DP EN GA L++EVA+KTND AGDGTTTA++LA+ II+ GL +VT+GANP+ ++ GI K V   VEE++  ++P+ G++DI  VA ISA +++ +G +IADA+++VG DGV+++E S
Sbjct:    2 AKSLLFGEQARRSMEAGVDKLADTVRVTLGPKGRNVVLDKKFGSPLITNDGVTIAREIELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVTAGANPIQIRTGIRKAVEKAVEEIKVISKPVNGKEDIARVAAISAASEE-VGKLIADAMERVGNDGVITVEES 178          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_CLOB6 (60 kDa chaperonin OS=Clostridium botulinum (strain 657 / Type Ba4) GN=groL PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 5.240e-51
Identity = 100/178 (56.18%), Postives = 141/178 (79.21%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AK + F + +R +M+AG+DKL+D V +TLGP+GRNVVLD+ FGSP + NDGVTIAR IEL DP EN GA L++EVA+KTND AGDGTTTA++LA+ II+ GL +VT+GANP+ ++ GI K V   VEE++  ++P+ G++DI  VA ISA +++ +G +IADA+++VG DGV+++E S
Sbjct:    2 AKSLLFGEQARRSMEAGVDKLADTVRVTLGPKGRNVVLDKKFGSPLITNDGVTIAREIELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVTAGANPIQIRTGIRKAVEKAVEEIKVISKPVNGKEDIARVAAISAASEE-VGKLIADAMERVGNDGVITVEES 178          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_CLOB1 (60 kDa chaperonin OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=groL PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 5.240e-51
Identity = 100/178 (56.18%), Postives = 141/178 (79.21%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AK + F + +R +M+AG+DKL+D V +TLGP+GRNVVLD+ FGSP + NDGVTIAR IEL DP EN GA L++EVA+KTND AGDGTTTA++LA+ II+ GL +VT+GANP+ ++ GI K V   VEE++  ++P+ G++DI  VA ISA +++ +G +IADA+++VG DGV+++E S
Sbjct:    2 AKSLLFGEQARRSMEAGVDKLADTVRVTLGPKGRNVVLDKKFGSPLITNDGVTIAREIELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVTAGANPIQIRTGIRKAVEKAVEEIKVISKPVNGKEDIARVAAISAASEE-VGKLIADAMERVGNDGVITVEES 178          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_BACHD (60 kDa chaperonin OS=Bacillus halodurans GN=groL PE=2 SV=2)

HSP 1 Score: 201.06 bits (510), Expect = 5.240e-51
Identity = 105/178 (58.99%), Postives = 139/178 (78.09%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AKDI F + +R +M  G+DKL+DAV +TLGP+GRNVVL++ FGSP + NDGVTIA+ IEL D  EN GA L+ EVASKTND AGDGTTTA+VLA+ +I+ GL +VTSGANP+ +++GI+K     VEEL K ++PIEG+D I  VA IS+  DD +G +IA+A+++VG DGV++IE S
Sbjct:    2 AKDIKFSEDARRSMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVTSGANPMVIRKGIEKATQVAVEELSKISKPIEGKDSIAQVAAISSA-DDEVGKIIAEAMERVGNDGVITIEES 178          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_ANATD (60 kDa chaperonin OS=Anaerocellum thermophilum (strain DSM 6725 / Z-1320) GN=groL PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 5.240e-51
Identity = 101/179 (56.42%), Postives = 144/179 (80.45%), Query Frame = 1
Query:  193 SAKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            +AK I FD+ +R A++ G++KL+D V +TLGP+GRNVVL++ FGSP++VNDGVTIA+ IEL DP EN GA ++REVASKTND AGDGTTTA+VLA+ +I+ GL ++ +GANP+ L++GI K V  +VEE+ K ++ + G++DI  VA+ISAG D+ IG ++ADA++KV  DGV+++E S
Sbjct:    2 AAKMILFDEEARRALERGVNKLADTVKVTLGPKGRNVVLEKKFGSPQIVNDGVTIAKEIELEDPFENMGAQIVREVASKTNDIAGDGTTTATVLAQAMIREGLKNIAAGANPMILRKGIQKAVDVVVEEIRKMSKKVRGKEDITYVASISAG-DEEIGKLVADAMEKVTNDGVITVEES 179          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_AMOA5 (60 kDa chaperonin OS=Amoebophilus asiaticus (strain 5a2) GN=groL PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 5.240e-51
Identity = 97/178 (54.49%), Postives = 137/178 (76.97%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AK I FD  +RA +++G+D +++AV +TLGP+GRNVV+D+ +G+P +  DG+++A+ IEL DP+EN GA LI+EVASKT D AGDGTTTA+VLA+ I   G+ +V +GANP+ LKRG+DK +  +VE L++ +R I    +I+ VATISA ND  IG MIADA+DKVG DGV+++E +
Sbjct:    2 AKHIIFDSEARAKLKSGVDTMANAVKVTLGPKGRNVVIDKKYGAPSITKDGISVAKEIELKDPVENLGAQLIKEVASKTADGAGDGTTTATVLAQSIFSAGIKNVAAGANPMDLKRGVDKAIEAVVERLKQNSRKISNSKEIEQVATISANNDSKIGKMIADAMDKVGKDGVITVEEA 179          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_METI4 (60 kDa chaperonin OS=Methylacidiphilum infernorum (isolate V4) GN=groL PE=3 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 8.938e-51
Identity = 99/179 (55.31%), Postives = 138/179 (77.09%), Query Frame = 1
Query:  193 SAKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            +AK + FD+ +R A+  G++KLS AV  TLGP GRNV+LD+ FGSP +  DGVT+A+ +EL DP EN GA L++EVASKT+D AGDGTTTA+VLA  I K GL +VT+GANP+ LKRG+DK V  +V++L++ +  ++G+++IK VAT+SA  D  IG +IADA+DKVG DG +++E +
Sbjct:    2 AAKQLIFDESARHALLRGVEKLSKAVKCTLGPAGRNVILDKKFGSPTITKDGVTVAKEVELEDPWENMGAQLVKEVASKTSDVAGDGTTTATVLAESIYKEGLKNVTAGANPMDLKRGVDKAVQAVVKQLKEISHIVKGKEEIKQVATVSANWDTSIGEIIADALDKVGKDGTVTVEEA 180          
The following BLAST results are available for this feature:
BLAST of CX043796 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_CLOBL5.240e-5156.1860 kDa chaperonin OS=Clostridium botulinum (strain... [more]
CH60_CLOBK5.240e-5156.1860 kDa chaperonin OS=Clostridium botulinum (strain... [more]
CH60_CLOBJ5.240e-5156.1860 kDa chaperonin OS=Clostridium botulinum (strain... [more]
CH60_CLOBH5.240e-5156.1860 kDa chaperonin OS=Clostridium botulinum (strain... [more]
CH60_CLOB65.240e-5156.1860 kDa chaperonin OS=Clostridium botulinum (strain... [more]
CH60_CLOB15.240e-5156.1860 kDa chaperonin OS=Clostridium botulinum (strain... [more]
CH60_BACHD5.240e-5158.9960 kDa chaperonin OS=Bacillus halodurans GN=groL P... [more]
CH60_ANATD5.240e-5156.4260 kDa chaperonin OS=Anaerocellum thermophilum (st... [more]
CH60_AMOA55.240e-5154.4960 kDa chaperonin OS=Amoebophilus asiaticus (strai... [more]
CH60_METI48.938e-5155.3160 kDa chaperonin OS=Methylacidiphilum infernorum ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_13D12_g Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-13D12-H23-1-7.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043796 ID=CX043796; Name=CX043796; organism=Citrus sinensis; type=EST; length=729bp
GTTGGTACCTTATCCGAAACAATTTCCCTCAGCAGACGCTTTACTCCGTT
TGGTTGATTGTTCGAAATGGCTTCTGCTAACGCCCTTTCTTCGGCTTCCA
TTCTTTGCTCTCCCAAACAGGGGAGCTTGAGGAGGAGAGGAAATCAGAAT
CAGGGTCAGAGAGTAAATTACAGGAGATTCGCTGTTAGAGCGTCTGCCAA
AGATATTGCTTTTGACCAGATCTCCAGGGCCGCAATGCAGGCCGGCATCG
ATAAGCTTTCCGATGCTGTTGGCCTTACTCTGGGTCCAAGAGGGAGAAAT
GTTGTTCTGGATGAATTTGGAAGTCCGAAAGTGGTTAATGATGGAGTAAC
AATAGCCCGAGCTATTGAGCTCGCAGATCCCATGGAAAATGCTGGTGCTG
CTCTTATTAGGGAGGTTGCAAGCAAAACCAATGACTCTGCTGGTGATGGA
ACAACAACTGCATCAGTTCTTGCACGAGAAATAATCAAACTAGGACTCCT
GAGTGTCACGTCTGGTGCAAATCCTGTCTCCTTGAAGAGAGGGATTGATA
AAACTGTACATGGGTTGGTAGAAGAGTTGGAGAAGAGGGCCAGGCCTATC
GAAGGTCGTGATGATATCAAAGCTGTTGCTACCATCTCTGCTGGGAATGA
TGACCTGATTGGGACAATGATCGCCGATGCAATTGACAAGGTTGGTCCTG
ATGGCGTCTTGTCAATCGAGTCATCATCA
back to top