CX043796

Overview
NameCX043796
Unique NameCX043796
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length729
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig892 contig Csv1_Contig892:117..845. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_DESRM (60 kDa chaperonin OS=Desulfotomaculum reducens (strain MI-1) GN=groL PE=3 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 7.566e-50
Identity = 99/178 (55.62%), Postives = 141/178 (79.21%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AK+I F + +R A++ G++ L++AV +TLGP+GRNVV+++ FG+P + NDGVTIAR IEL D  EN GA L++EVA+KTND AGDGTTTA+VLA+ +++ GL +V +GANP+ +KRGI+K V   VEE++  A+PIE ++ I  VAT+SA NDD IG +IA+A++KVG DGV+++E S
Sbjct:    2 AKEIIFREDARRALERGVNALAEAVKVTLGPKGRNVVIEKKFGAPTITNDGVTIAREIELEDNFENMGAQLVKEVATKTNDVAGDGTTTATVLAQALVREGLKNVAAGANPMIIKRGIEKAVEKAVEEIKAMAKPIESKEAIAQVATVSA-NDDSIGNLIAEAMEKVGKDGVITVEES 178          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH602_SYNY3 (60 kDa chaperonin 2 OS=Synechocystis sp. (strain PCC 6803) GN=groL2 PE=1 SV=4)

HSP 1 Score: 197.208 bits (500), Expect = 7.566e-50
Identity = 98/178 (55.06%), Postives = 144/178 (80.90%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLD-EFGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            +K I+F   SR +++AGI+ L+DAV +TLGP+GRNV+L+ ++G+P++VNDG+T+A+ IEL++P ENAGA LI+EVASKT + AGDGTTTA+++A+ +++ GL +V +GANPV+L+RGI+K    LV+E+E  A+P+EG   I  VAT+S+GND  +G MIADA+DKV  DGV+++E S
Sbjct:    2 SKLISFKDESRRSLEAGINALADAVRITLGPKGRNVLLEKQYGAPQIVNDGITVAKEIELSNPEENAGAKLIQEVASKTKEIAGDGTTTATIIAQALVREGLRNVAAGANPVALRRGIEKVTTFLVQEIEAVAKPVEG-SAIAQVATVSSGNDPEVGAMIADAMDKVTKDGVITVEES 178          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH602_SALRD (60 kDa chaperonin 2 OS=Salinibacter ruber (strain DSM 13855) GN=groL2 PE=3 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 7.566e-50
Identity = 96/178 (53.93%), Postives = 134/178 (75.28%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AK I FD  +R+A+Q G+D+++ AV +TLGP+GRNVVL++ FG+P +  DGVT+A+ IEL + + N GA +++E ASKTND AGDGTTTA+VLA+ +I  G+ SVTSGANP+ +KRGI      +V  L  ++ P+EG+D I  VATISA NDD IG +IADA ++VG DGV+++E +
Sbjct:    2 AKQIKFDSDARSALQEGVDQMAKAVKVTLGPKGRNVVLEKSFGAPTITKDGVTVAKEIELEERLPNIGAQVLKEAASKTNDDAGDGTTTATVLAQSVINAGMKSVTSGANPMDVKRGITAAAEEVVTHLRNQSDPVEGKDRISQVATISANNDDAIGDLIADAFERVGQDGVITVEEA 179          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH602_PROM1 (60 kDa chaperonin 2 OS=Prochlorococcus marinus (strain NATL1A) GN=groL2 PE=3 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 7.566e-50
Identity = 97/176 (55.11%), Postives = 139/176 (78.98%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIE 720
            AK I +++ +R A++ GID L+++V +TLGP+GRNVVL++ FG+P+++NDGVTIA+ IEL D +EN G ALIR+ ASKTND+AGDGTTTA+VLA  ++K GL +V +GAN ++LK+GIDK    LVE+++  ++PI   + I    TI+AGND+ +G MIADA+DKVG +GV+S+E
Sbjct:    2 AKRIIYNEQARRALERGIDILAESVAVTLGPKGRNVVLEKKFGAPQIINDGVTIAKEIELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAMVKAGLKNVAAGANAITLKKGIDKATDFLVEKIKDHSKPISDSNAIAQCGTIAAGNDEEVGKMIADAMDKVGKEGVISLE 177          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH602_ACAM1 (60 kDa chaperonin 2 OS=Acaryochloris marina (strain MBIC 11017) GN=groL2 PE=3 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 7.566e-50
Identity = 100/176 (56.82%), Postives = 138/176 (78.41%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIE 720
            AK I +++ +R A++ G+D L ++V +TLGP+GRNVVL++ FG+P++VNDGVTIA+ IEL D +EN G ALIR+ ASKTND+AGDGTTTA+VLA  ++K G+ +V +GAN +SLKRGI+K    LVE++ + AR +E    I  V TISAGNDD +G MIA+A+DKVG +GV+S+E
Sbjct:    2 AKRIIYNENARRALEKGMDILCESVAVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEIELEDNIENTGVALIRQAASKTNDAAGDGTTTATVLAHAMVKEGMRNVVAGANAISLKRGIEKAAGFLVEKIAENARSVEDSTAIAQVGTISAGNDDEVGQMIANAMDKVGKEGVISLE 177          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_GEOKA (60 kDa chaperonin OS=Geobacillus kaustophilus GN=groL PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.882e-50
Identity = 102/178 (57.30%), Postives = 139/178 (78.09%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AK I F + +R AM  G+DKL+DAV +TLGP+GRNVVL++ FGSP + NDGVTIA+ IEL DP EN GA L+ EVASKTND AGDGTTTA+VLA+ +I+ GL +V +GANP+ ++RGI+K V   VEEL+  ++PI+G++ I  VA ISA  D+ +G +IA+A+++VG DGV+++E S
Sbjct:    2 AKQIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVAAGANPMGIRRGIEKAVAVAVEELKAISKPIKGKESIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEES 178          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_CHLL2 (60 kDa chaperonin OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=groL PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.882e-50
Identity = 100/179 (55.87%), Postives = 136/179 (75.98%), Query Frame = 1
Query:  193 SAKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            +AKDI FD  +RA ++ G+DKL++AV +TLGP GRNV++D+ FG+P    DGVT+A+ IELAD +EN GA ++REVASKT+D AGDGTTTA+VLA+ I + GL +V +GA P+ LKRGID+ V  +V EL   +R I G+ +I  V TISA ND  IG +IA+A+DKVG DGV+++E +
Sbjct:    2 TAKDIIFDSDARAKLKVGVDKLANAVKVTLGPAGRNVLIDKKFGAPTSTKDGVTVAKEIELADAVENMGAQMVREVASKTSDVAGDGTTTATVLAQAIYREGLKNVAAGARPIDLKRGIDRAVKEVVAELRNISRSISGKKEIAQVGTISANNDPEIGELIAEAMDKVGKDGVITVEEA 180          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_BACP3 (60 kDa chaperonin OS=Bacillus PS3 GN=groL PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.882e-50
Identity = 102/178 (57.30%), Postives = 139/178 (78.09%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AK I F + +R AM  G+DKL+DAV +TLGP+GRNVVL++ FGSP + NDGVTIA+ IEL DP EN GA L+ EVASKTND AGDGTTTA+VLA+ +I+ GL +V +GANP+ ++RGI+K V   VEEL+  ++PI+G++ I  VA ISA  D+ +G +IA+A+++VG DGV+++E S
Sbjct:    2 AKQIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVAAGANPMGIRRGIEKAVAVAVEELKAISKPIKGKESIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEES 178          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_SULSY (60 kDa chaperonin OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=groL PE=3 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.291e-49
Identity = 99/179 (55.31%), Postives = 139/179 (77.65%), Query Frame = 1
Query:  193 SAKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            +AK + +   +RA ++AG+DKL++AV +TLGPRGR V+L++ +GSP V  DGV++A+ IEL DP EN  A L++EVASKT D AGDGTTTA+VL + I + GL ++ SGANP+ +KRGID+ V  +VEEL+K ++P+ GR +I+ VATISA ND  IG +IADA++KVG DGV+++E S
Sbjct:    2 AAKKLVYGDEARAKLKAGVDKLANAVKVTLGPRGREVILEKKWGSPVVTKDGVSVAKEIELTDPYENMAAQLVKEVASKTADVAGDGTTTATVLTQAIYEEGLKAIASGANPIYVKRGIDEAVKIIVEELKKISKPVTGRKEIEQVATISANNDPEIGKIIADAMEKVGKDGVITVEES 180          
BLAST of CX043796 vs. ExPASy Swiss-Prot
Match: CH60_LACRJ (60 kDa chaperonin OS=Lactobacillus reuteri (strain JCM 1112) GN=groL PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.686e-49
Identity = 98/178 (55.06%), Postives = 138/178 (77.53%), Query Frame = 1
Query:  196 AKDIAFDQISRAAMQAGIDKLSDAVGLTLGPRGRNVVLDE-FGSPKVVNDGVTIARAIELADPMENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKRGIDKTVHGLVEELEKRARPIEGRDDIKAVATISAGNDDLIGTMIADAIDKVGPDGVLSIESS 726
            AK+I F + +R+AM +G+DKL+D V  T+GP+GRNVVL++ +G+P + NDGVTIA++IEL +  EN GA L+ EVASKTND AGDGTTTA+VL + I+  G+ +VTSGANPV ++RGIDK     VE L+K +  ++ +DDI+ +A+ISA N + +G +IADA++KVG DGV++IE S
Sbjct:    2 AKEIKFSEDARSAMLSGVDKLADTVKTTMGPKGRNVVLEQSYGTPTITNDGVTIAKSIELENQFENMGAKLVAEVASKTNDIAGDGTTTATVLTQAIVNAGMKNVTSGANPVGIRRGIDKATEVAVEALKKMSHDVKTKDDIEQIASISAANPE-VGKLIADAMEKVGHDGVITIEDS 178          
The following BLAST results are available for this feature:
BLAST of CX043796 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_DESRM7.566e-5055.6260 kDa chaperonin OS=Desulfotomaculum reducens (st... [more]
CH602_SYNY37.566e-5055.0660 kDa chaperonin 2 OS=Synechocystis sp. (strain P... [more]
CH602_SALRD7.566e-5053.9360 kDa chaperonin 2 OS=Salinibacter ruber (strain ... [more]
CH602_PROM17.566e-5055.1160 kDa chaperonin 2 OS=Prochlorococcus marinus (st... [more]
CH602_ACAM17.566e-5056.8260 kDa chaperonin 2 OS=Acaryochloris marina (strai... [more]
CH60_GEOKA9.882e-5057.3060 kDa chaperonin OS=Geobacillus kaustophilus GN=g... [more]
CH60_CHLL29.882e-5055.8760 kDa chaperonin OS=Chlorobium limicola (strain D... [more]
CH60_BACP39.882e-5057.3060 kDa chaperonin OS=Bacillus PS3 GN=groL PE=3 SV=... [more]
CH60_SULSY1.291e-4955.3160 kDa chaperonin OS=Sulfurihydrogenibium sp. (str... [more]
CH60_LACRJ1.686e-4955.0660 kDa chaperonin OS=Lactobacillus reuteri (strain... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_13D12_g Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-13D12-H23-1-7.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043796 ID=CX043796; Name=CX043796; organism=Citrus sinensis; type=EST; length=729bp
GTTGGTACCTTATCCGAAACAATTTCCCTCAGCAGACGCTTTACTCCGTT
TGGTTGATTGTTCGAAATGGCTTCTGCTAACGCCCTTTCTTCGGCTTCCA
TTCTTTGCTCTCCCAAACAGGGGAGCTTGAGGAGGAGAGGAAATCAGAAT
CAGGGTCAGAGAGTAAATTACAGGAGATTCGCTGTTAGAGCGTCTGCCAA
AGATATTGCTTTTGACCAGATCTCCAGGGCCGCAATGCAGGCCGGCATCG
ATAAGCTTTCCGATGCTGTTGGCCTTACTCTGGGTCCAAGAGGGAGAAAT
GTTGTTCTGGATGAATTTGGAAGTCCGAAAGTGGTTAATGATGGAGTAAC
AATAGCCCGAGCTATTGAGCTCGCAGATCCCATGGAAAATGCTGGTGCTG
CTCTTATTAGGGAGGTTGCAAGCAAAACCAATGACTCTGCTGGTGATGGA
ACAACAACTGCATCAGTTCTTGCACGAGAAATAATCAAACTAGGACTCCT
GAGTGTCACGTCTGGTGCAAATCCTGTCTCCTTGAAGAGAGGGATTGATA
AAACTGTACATGGGTTGGTAGAAGAGTTGGAGAAGAGGGCCAGGCCTATC
GAAGGTCGTGATGATATCAAAGCTGTTGCTACCATCTCTGCTGGGAATGA
TGACCTGATTGGGACAATGATCGCCGATGCAATTGACAAGGTTGGTCCTG
ATGGCGTCTTGTCAATCGAGTCATCATCA
back to top