DC900365

Overview
NameDC900365
Unique NameDC900365
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length609
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10161 contig Csv1_Contig10161:68..676. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900365 vs. ExPASy Swiss-Prot
Match: PRP45_USTMA (Pre-mRNA-processing protein 45 OS=Ustilago maydis GN=PRP45 PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 6.885e-21
Identity = 65/184 (35.33%), Postives = 106/184 (57.61%), Query Frame = 3
Query:    3 ERERERRLEAKDAAMG---KKSKITRDRDRDISEKFALGMASTGAARGGEVTFXQRLFNQEKGMDSGFATDDQYNVYDKGLFTAQPTLSTLYR--PKKDADDDMYGGNADEQM-EKIMKTDRF----KPDKGFAGSSER-----SGP-RDRPVEFEKEAEEADPFGLDEFLTEVEKGGKKALDK 506
            ER RER+ E + + MG   +  ++ R+++RDISEK ALG+A   A++  E     RLFNQ + + +G+  +D YN+YDK LF+     + +YR    +   +D+Y G  D  + E++ K DRF       +G  G ++R     S P R  PV+FEK+   +DPF +++FL + ++G K+  D+
Sbjct:  444 ERRRERQRELRMSNMGIEQRTKQLLREQNRDISEKVALGLAKPTASK--ESMTDSRLFNQGESLAAGYGDEDSYNLYDKPLFSGSSAAAAIYRRPAARGGANDIYSGADDTALEEELGKNDRFGLGQSKFRGVQGDADRDSGSGSAPVRSGPVQFEKDT--SDPFAINQFLEDAKRGIKRTSDQ 623          
BLAST of DC900365 vs. ExPASy Swiss-Prot
Match: PRP45_SCHPO (Pre-mRNA-processing protein 45 OS=Schizosaccharomyces pombe GN=prp45 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 7.124e-18
Identity = 63/165 (38.18%), Postives = 90/165 (54.55%), Query Frame = 3
Query:    3 ERERERRLEAKDAAMG--KKSKIT-RDRDRDISEKFALGMASTGAARGGEVTFXQRLFNQEKGMDSGFATDDQYNVYDKGLFTAQPTLSTLYRPKKDADDDMYGGNADEQMEKIMKTDRF----KPDKGFAGSSERSGPRDRPVEFEKEAEEADPFGLDEFLTEV 476
            ER R+   + + + MG  K++K+  +DR RD++E+ ALG++    +   +     RLFNQ  G+ SGF  +D YNVYDK  + A P+ STLYRP       +   +A  ++E+I    R+       K F GS E    R  PV FEK+   ADPFG+D FL  V
Sbjct:  397 ERRRQAEKDLRLSRMGAEKRAKLAEKDRPRDVAERVALGLSKPSMS--SDTMIDSRLFNQASGLGSGFQDEDSYNVYDKP-WRAAPS-STLYRPGATLSRQV---DASAELERITSESRYDVLGNAHKKFKGSDEVVESRAGPVTFEKDI--ADPFGVDTFLNNV 552          
BLAST of DC900365 vs. ExPASy Swiss-Prot
Match: PRP45_YARLI (Pre-mRNA-processing protein 45 OS=Yarrowia lipolytica GN=PRP45 PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.372e-13
Identity = 53/151 (35.10%), Postives = 78/151 (51.66%), Query Frame = 3
Query:    3 ERERERRLEAKDAAMGKKSKI---TRDRDRDISEKFALGMASTGAARGGEVTFXQRLFNQEKGMDSGFATDDQYNVYDKGLFTAQPTLSTLYRPKKDADDDMYGGNADEQMEKIMKTDRF----KPDKGFAGSSERSGPRDRPVEFEKEAE 434
            ER+RE   + + + MG + KI    ++  RDISE+ ALG A       GE  F  RLF++   +  GF  +DQY  YDK LF+AQ  + ++YRP    D       A++ ++++    RF    K  KGF G+      RD PV F ++ E
Sbjct:  429 ERKREAERDLRLSKMGTQQKIKQLAKENSRDISERVALGAAQPQKL-AGEAQFDSRLFSKSGSLQRGF-NEDQY--YDKSLFSAQEAVQSIYRPSASGD-----SVAEDTIDRLETEKRFDVLGKAGKGFEGADGEE--RDGPVRFVRDEE 568          
The following BLAST results are available for this feature:
BLAST of DC900365 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
PRP45_USTMA6.885e-2135.33Pre-mRNA-processing protein 45 OS=Ustilago maydis ... [more]
PRP45_SCHPO7.124e-1838.18Pre-mRNA-processing protein 45 OS=Schizosaccharomy... [more]
PRP45_YARLI2.372e-1335.10Pre-mRNA-processing protein 45 OS=Yarrowia lipolyt... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900365 VSS Citrus sinensis cDNA clone VS28933 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900365 ID=DC900365|Name=DC900365|organism=Citrus sinensis|type=EST|length=609bp
GGGAGAGGGAAAGGGAGAGAAGGTTGGAGGCCAAGGATGCTGCTATGGGA
AAGAAGAGTAAGATTACTAGAGACAGAGATCGTGATATTAGTGAGAAATT
TGCTCTTGGCATGGCCTCGACTGGGGCGGCAAGAGGAGGTGAGGTTACTT
TTNATCAAAGGCTGTTCAACCAGGAGAAAGGAATGGATTCTGGTTTCGCC
ACTGATGACCAGTACAATGTGTATGACAAGGGCCTGTTTACTGCTCAGCC
CACACTTTCAACCCTATATAGGCCCAAGAAAGATGCAGATGATGACATGT
ATGGAGGAAACGCAGATGAACAGATGGAGAAGATTATGAAGACTGATCGG
TTCAAACCTGACAAGGGATTTGCTGGTAGTTCTGAGAGGTCTGGTCCTAG
AGACAGACCAGTCGAGTTTGAGAAGGAGGCTGAAGAAGCCGATCCATTTG
GTCTTGATGAGTTCTTGACAGAGGTGGAGAAGGGGGGGAAGAAAGCATTG
GACAAAGTTGGNACTGGAGGGACAATGAGAGCGAGTGCCGGATCTTCAAT
GCGAGATGATTATGGAGGTTCTGGTAGATCTCGCATAGGATTTGAAAGGG
GCCGTTAAG
back to top