DC900364

Overview
NameDC900364
Unique NameDC900364
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1050
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL3_ARATH (Agamous-like MADS-box protein AGL3 OS=Arabidopsis thaliana GN=AGL3 PE=1 SV=2)

HSP 1 Score: 140.198 bits (352), Expect = 1.932e-32
Identity = 74/197 (37.56%), Postives = 118/197 (59.90%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQI---FNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKPAEEHHHQ 635
            MGRGK+ +KRIEN   RQVTF+KRR GLLKK +ELSVLCDA+I L+IFS+ GKL ++C+ P  M + +++  K +   +  + S + +   + +   L+     LQ S R   GE+L  +  ++L+ LE ++++S+ ++R  K   +  QL +L+ KE ML E N ++ R +++  AAL        A   ++ H Q
Sbjct:    1 MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEIALLIFSNRGKLYEFCSSPSGMARTVDKYRKHSYATMDPNQSAKDLQDKYQDYLKLKSRVEILQHSQRHLLGEELSEMDVNELEHLERQVDASLRQIRSTKARSMLDQLSDLKTKEEMLLETNRDLRRKLEDSDAALTQSFWGSSAAEQQQQHQQ 197          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MADS1_ORYSJ (MADS-box transcription factor 1 OS=Oryza sativa subsp. japonica GN=MADS1 PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 4.305e-32
Identity = 86/237 (36.29%), Postives = 131/237 (55.27%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAA----LEYQQAAMEAKPA-----EEHHHQVLDH-FPFLGDQQPSSVLQLATNSIPHQIHPYHH 734
            MGRGK+ +KRIEN  +RQVTF+KRR GLLKK +ELS+LCDA++ LIIFS  G+L ++ +     + +   R     ++       E  + E   L+     LQ + R   GEDLG +   +L+QLE+++E S+ ++R RKN+ L  QL +L+ KE+ L++ N ++ + +QE  A     + +Q     +  +     + HHHQ L H  P  GD      LQ+      H  H +HH
Sbjct:    1 MGRGKVELKRIENKISRQVTFAKRRNGLLKKAYELSLLCDAEVALIIFSGRGRLFEFSSSSCMYKTLERYRSCNYNSQDAAAPENEINYQEYLKLKTRVEFLQTTQRNILGEDLGPLSMKELEQLENQIEVSLKQIRSRKNQALLDQLFDLKSKEQQLQDLNKDLRKKLQETSAENVLHMSWQDGGGHSGSSTVLADQPHHHQGLLHPHPDQGDHS----LQIGY----HHPHAHHH 229          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MADS1_ORYSI (MADS-box transcription factor 1 OS=Oryza sativa subsp. indica GN=MADS1 PE=2 SV=2)

HSP 1 Score: 139.043 bits (349), Expect = 4.305e-32
Identity = 86/237 (36.29%), Postives = 131/237 (55.27%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAA----LEYQQAAMEAKPA-----EEHHHQVLDH-FPFLGDQQPSSVLQLATNSIPHQIHPYHH 734
            MGRGK+ +KRIEN  +RQVTF+KRR GLLKK +ELS+LCDA++ LIIFS  G+L ++ +     + +   R     ++       E  + E   L+     LQ + R   GEDLG +   +L+QLE+++E S+ ++R RKN+ L  QL +L+ KE+ L++ N ++ + +QE  A     + +Q     +  +     + HHHQ L H  P  GD      LQ+      H  H +HH
Sbjct:    1 MGRGKVELKRIENKISRQVTFAKRRNGLLKKAYELSLLCDAEVALIIFSGRGRLFEFSSSSCMYKTLERYRSCNYNSQDAAAPENEINYQEYLKLKTRVEFLQTTQRNILGEDLGPLSMKELEQLENQIEVSLKQIRSRKNQALLDQLFDLKSKEQQLQDLNKDLRKKLQETSAENVLHMSWQDGGGHSGSSTVLADQPHHHQGLLHPHPDQGDHS----LQIGY----HHPHAHHH 229          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL21_ARATH (Agamous-like MADS-box protein AGL21 OS=Arabidopsis thaliana GN=AGL21 PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 4.305e-32
Identity = 80/199 (40.20%), Postives = 126/199 (63.32%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIER--RLKVTGTRIPEHDSREQIF-NELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQE-HRAALEYQQAAMEAKPAEEHHHQV 638
            MGRGKI I+RI++ T+RQVTFSKRR GL+KK  EL++LCDA++GLIIFSSTGKL  + +    M+ +I+R  + K+   ++    S  + +  E AVLR+E   LQ + R+  GE L  +  ++L+ LE+++E S+  +R RK +LL Q++  L +K  ++ +EN ++ R +Q  H+  +E  + A  A      H +V
Sbjct:    1 MGRGKIVIQRIDDSTSRQVTFSKRRKGLIKKAKELAILCDAEVGLIIFSSTGKLYDFASS--SMKSVIDRYNKSKIEQQQLLNPASEVKFWQREAAVLRQELHALQENHRQMMGEQLNGLSVNELNSLENQIEISLRGIRMRKEQLLTQEIQELSQKRNLIHQENLDLSRKVQRIHQENVELYKKAYMANTNGFTHREV 197          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD15_ORYSJ (MADS-box transcription factor 15 OS=Oryza sativa subsp. japonica GN=MADS15 PE=1 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 5.623e-32
Identity = 77/184 (41.85%), Postives = 113/184 (61.41%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTR----IPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQ 593
            MGRGK+ +KRIEN   RQVTFSKRR GLLKK HE+SVLCDA++  I+FS  GKL +Y T+  RM++I+ER  + +         E +S     +E   L+ +   +Q   +   GEDL S+   +L QLE +LESS+  +  RK+ L+ + +  L++KER L+EEN  + + + E +  +  QQ
Sbjct:    1 MGRGKVQLKRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAAIVFSPKGKLYEYATDS-RMDKILERYERYSYAEKALISAESESEGNWCHEYRKLKAKIETIQKCHKHLMGEDLESLNLKELQQLEQQLESSLKHIISRKSHLMLESISELQKKERSLQEENKALQKELVERQKNVRGQQ 183          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL9_SINAL (Agamous-like MADS-box protein AGL9 homolog OS=Sinapis alba GN=AGL9 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.636e-31
Identity = 84/200 (42.00%), Postives = 120/200 (60.00%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVT-GTRIPEHDSREQIFNELA------VLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKPAEEHHH 632
            MGRG++ +KRIEN   RQVTF+KRR GLLKK +ELSVLCDA++ LIIFS+ GKL ++C+    M + +ER  K   G   P   SRE +  EL+       L++    LQ + R   GEDLG +   +L+ LE +L+SS+ ++R  + + +  QL++L+ KERML E N  +       R A  YQ   ++  P +E HH
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS-SMIRTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKTL-----RLRLADGYQM-PLQLNPNQEDHH 193          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL11_ARATH (Agamous-like MADS-box protein AGL11 OS=Arabidopsis thaliana GN=AGL11 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.137e-31
Identity = 79/200 (39.50%), Postives = 119/200 (59.50%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKV----TGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKPAEEHHHQVL 641
            MGRGKI IKRIEN T RQVTF KRR GLLKK +ELSVLCDA++ LI+FS+ G+L +Y     R    IER  K     T T   +  +      E A LR++ + +Q S R   G+ L S+   +L Q+E+ LE +++++R +K+ELL  +++N +++E  +E +N N+Y            +    E +  ++HHHQ++
Sbjct:    1 MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANNNIR--STIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLSVKELKQVENRLEKAISRIRSKKHELLLVEIENAQKRE--IELDNENIY-----------LRTKVAEVERYQQHHHQMV 185          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MADS8_ORYSJ (MADS-box transcription factor 8 OS=Oryza sativa subsp. japonica GN=MADS8 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 2.790e-31
Identity = 91/247 (36.84%), Postives = 136/247 (55.06%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKV------TGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKPAEEHHHQVLDHFPFL---GDQQPSSVLQLATNSIPHQIHPYHHL--QLAQPNLQ 761
            MGRG++ +KRIEN   RQVTF+KRR GLLKK +ELSVLCDA++ LIIFS+ GKL ++C+    M + +ER  K       T  +  E++  +   NE   L+     LQ + R   GEDLG++   +L+QLE +L+SS+  +R  + + +  QL +L+R+E+ML E N  + R ++E                + + H QV +H   L     Q P +V Q+     PH  + + H     A+P LQ
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSGQ-SMTRTLERYQKFSYGGPDTAIQNKENELVQSSRNEYLKLKARVENLQRTQRNLLGEDLGTLGIKELEQLEKQLDSSLRHIRSTRTQHMLDQLTDLQRREQMLCEANKCLRRKLEE----------------SNQLHGQVWEHGATLLGYERQSPHAVQQVP----PHGGNGFFHSLEAAAEPTLQ 226          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL19_ARATH (Agamous-like MADS-box protein AGL19 OS=Arabidopsis thaliana GN=AGL19 PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 2.790e-31
Identity = 73/205 (35.61%), Postives = 127/205 (61.95%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRME-QIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNM-YRWIQEHRAALEYQQAAMEAKPAEEHHHQVLDHFPFLG 662
            M RGK  +KRIEN T+RQVTFSKRR GLLKK  ELSVLCDA++ L+IFS   KL ++ +       +  +RR+K  G     +D+ +Q  +E + L K+  +L++S R+  GE + +   ++L QLE++L+ S++++R +K +LL+++++ L+ +ER L +EN ++  +W+    A +   Q+ + +       +  ++   F+G
Sbjct:    1 MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRSKLYEFSSSSIAATIERYQRRIKEIGNNHKRNDNSQQARDETSGLTKKIEQLEISKRKLLGEGIDACSIEELQQLENQLDRSLSRIRAKKYQLLREEIEKLKAEERNLVKENKDLKEKWLGMGTATIASSQSTLSSSEVNIDDNMEVETGLFIG 205          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD18_ORYSJ (MADS-box transcription factor 18 OS=Oryza sativa subsp. japonica GN=MADS18 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 3.644e-31
Identity = 71/177 (40.11%), Postives = 112/177 (63.28%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVT----GTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHR 572
            MGRG + ++RIEN   RQVTFSKRR GLLKK HE+SVLCDA + LI+FS+ GKL ++ +    ME I+ER  + +        P  + +E   +E  +L+ +   LQ S R+  GE L ++   +L QLEH+LE S+  +R +KN+LL + +  L++KE+ L+ +N+ + + ++  +
Sbjct:    1 MGRGPVQLRRIENKINRQVTFSKRRNGLLKKAHEISVLCDADVALIVFSTKGKLYEFSSHS-SMEGILERYQRYSFDERAVLEPNTEDQENWGDEYGILKSKLDALQKSQRQLLGEQLDTLTIKELQQLEHQLEYSLKHIRSKKNQLLFESISELQKKEKSLKNQNNVLQKLMETEK 176          
The following BLAST results are available for this feature:
BLAST of DC900364 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
AGL3_ARATH1.932e-3237.56Agamous-like MADS-box protein AGL3 OS=Arabidopsis ... [more]
MADS1_ORYSJ4.305e-3236.29MADS-box transcription factor 1 OS=Oryza sativa su... [more]
MADS1_ORYSI4.305e-3236.29MADS-box transcription factor 1 OS=Oryza sativa su... [more]
AGL21_ARATH4.305e-3240.20Agamous-like MADS-box protein AGL21 OS=Arabidopsis... [more]
MAD15_ORYSJ5.623e-3241.85MADS-box transcription factor 15 OS=Oryza sativa s... [more]
AGL9_SINAL1.636e-3142.00Agamous-like MADS-box protein AGL9 homolog OS=Sina... [more]
AGL11_ARATH2.137e-3139.50Agamous-like MADS-box protein AGL11 OS=Arabidopsis... [more]
MADS8_ORYSJ2.790e-3136.84MADS-box transcription factor 8 OS=Oryza sativa su... [more]
AGL19_ARATH2.790e-3135.61Agamous-like MADS-box protein AGL19 OS=Arabidopsis... [more]
MAD18_ORYSJ3.644e-3140.11MADS-box transcription factor 18 OS=Oryza sativa s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900364 VSS Citrus sinensis cDNA clone VS28932 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900364 ID=DC900364|Name=DC900364|organism=Citrus sinensis|type=EST|length=1050bp
CGGCACGAGTTACAAGCAAAGCAAGAGAAAGCGAACAAGAAAAGATCAGA
ATAATGGGACGTGGGAAGATAGCGATCAAGAGGATTGAGAACCCGACGAC
GAGGCAAGTAACCTTCTCGAAACGGAGAGCTGGGCTTTTGAAGAAGACCC
ATGAACTCTCAGTGCTTTGTGATGCTCAAATTGGCCTCATCATCTTCTCA
AGTACCGGAAAATTGTGCCAGTACTGCACTGAGCCTTTCAGAATGGAGCA
AATCATTGAGAGGCGCCTCAAAGTTACAGGGACTCGCATCCCTGAGCATG
ATAGCCGGGAACAAATATTCAATGAGTTGGCGGTTCTGAGAAAAGAAACC
CGCCGCCTTCAGCTGAGTATGCGACGCTACACTGGTGAGGACTTGGGTTC
TATACCTTATGATGATCTCGATCAACTTGAACATGAGCTTGAAAGCTCTG
TTAACAAGGTCCGAGATCGCAAGAATGAGCTTCTTCAACAACAGCTGGAT
AATCTTCGTAGGAAGGAGCGAATGCTGGAGGAAGAGAACAGCAACATGTA
CCGTTGGATTCAGGAGCATAGGGCAGCATTGGAGTATCAGCAAGCTGCAA
TGGAAGCAAAGCCAGCTGAGGAGCATCATCATCAAGTCTTGGATCATTTT
CCATTCTTGGGAGATCAACAACCCAGTAGTGTGCTTCAGCTTGCAACCAA
CAGTATCCCTCATCAAATTCACCCTTATCACCATCTTCAGCTTGCTCAGC
CCAACCTTCAGGATCCCAATGTCTAGTATCAGCTTAAGAAGGATGTCCGA
AAGAGGTTGCGAAAGAGTAGATGATATAATCATTATGAAGATGACTCATA
ATTATCTCCTGGTTATTAATTACCTTATATAGTTTGCAGTAATTAAATTA
TTATTTTATGTTTTAGAAGCTACGAATGATCTGCTCGCTATGTGTGTTCC
TCATATTTATAACTCTTTGTATATGTATTGAGATATGTGACTTCAAACAA
TTGTACTGTGGTATGTTTTAGACATGAAAAAGTACTTGAATTTCTGCCGT
back to top