DC900364

Overview
NameDC900364
Unique NameDC900364
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1050
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD21_ORYSJ (MADS-box transcription factor 21 OS=Oryza sativa subsp. japonica GN=MADS21 PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 3.411e-29
Identity = 76/194 (39.18%), Postives = 120/194 (61.86%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTR-----IPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQE-HRAALEYQQAAMEAKPA 617
            MGRGKI IKRIEN T+RQVTF KRR GLLKK +EL++LCDA+I LI+FSS G+L ++ +        IER  K + +      + + +S +    E A +R + + LQ + R   GE +G++   +L  LE+ LE  ++++R +K+ELL  +++ ++++E  L+ EN  +   + E  RA  + QQAA + + A
Sbjct:    1 MGRGKIEIKRIENKTSRQVTFCKRRNGLLKKAYELAILCDAEIALIVFSSRGRLYEF-SNVNSTRSTIERYKKASASTSGSAPVIDVNSHQYFQQEAAKMRHQIQTLQNANRHLIGESIGNMTAKELKSLENRLEKGISRIRSKKHELLFSEIEYMQKREADLQNENMFLRAKVAEAERAEHDDQQAAEDDEMA 193          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL14_ARATH (Agamous-like MADS-box protein AGL14 OS=Arabidopsis thaliana GN=AGL14 PE=2 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 3.411e-29
Identity = 72/165 (43.64%), Postives = 110/165 (66.67%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTE---PFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEEN 539
            M RGK  +KRIEN T+RQVTFSKRR GLLKK  ELSVLCDA++ LIIFS  GKL ++ +    P  +E+  ++R++  G+    +D+ +Q  +E   L ++   L++S R+  GE L +   ++L QLE++L+ S+ K+R +K +LL+++ + L+ KER L  EN
Sbjct:    1 MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSSSSIPKTVER-YQKRIQDLGSNHKRNDNSQQSKDETYGLARKIEHLEISTRKMMGEGLDASSIEELQQLENQLDRSLMKIRAKKYQLLREETEKLKEKERNLIAEN 164          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MTF1_PEA (MADS-box transcription factor 1 OS=Pisum sativum GN=MTF1 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 4.455e-29
Identity = 82/215 (38.14%), Postives = 124/215 (57.67%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVT-GTRIPEHDSREQIFNELA------VLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRA-ALEYQQAAMEAKPAEEHHHQVLDHFPFLGDQQP 674
            MGRG++ +KR+EN   RQVTF+KRR GLLKK +ELSVLCDA++ LI+FS+ GKL ++C+    M + +ER  K   G       S+E +  EL+       L+     LQ S R   GEDLG +   DL+ LE +L+SS+ ++R  + + +  QL +L+RKE +L E N  + + ++ ++  +L+   +A +       HHQ   H   L   QP
Sbjct:    1 MGRGRVELKRVENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSTS-SMLKTLERYQKCNYGAPEGNVTSKEALVLELSSQQEYLKLKARYESLQRSQRNLMGEDLGPLSSKDLETLERQLDSSLKQIRSTRTQFMLDQLGDLQRKEHLLCEANRALRQRMEGYQINSLQLNLSAEDM--GYGRHHQGHTHGDELFQVQP 212          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AG_PANGI (Floral homeotic protein AGAMOUS OS=Panax ginseng GN=AG2 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 4.455e-29
Identity = 76/184 (41.30%), Postives = 109/184 (59.24%), Query Frame = 3
Query:   48 RIMGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKV----TGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEY 587
            R +GRGKI IKRIEN T RQVTF KRR GLLKK +ELSVLCDA++ LI+FS+ G+L +Y      ++  IER  K       T      + +    E + LR+E   +Q + R   GE LGS+   DL  LE +LE  ++++R +KNELL  +++ +++KE  L   N  +   I E+  A ++
Sbjct:   15 RKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN--SVKGTIERYKKACTDSPNTSSVSEANAQFYQQEASKLRQEISSIQKNNRNMMGESLGSLTVRDLKGLETKLEKGISRIRSKKNELLFAEIEYMQKKEIDLHNNNQYLRAKIAENERAQQH 196          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: SEP1_ARATH (Developmental protein SEPALLATA 1 OS=Arabidopsis thaliana GN=SEP1 PE=1 SV=2)

HSP 1 Score: 128.642 bits (322), Expect = 5.819e-29
Identity = 72/166 (43.37%), Postives = 103/166 (62.05%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHD----SREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEEN 539
            MGRG++ +KRIEN   RQVTF+KRR GLLKK +ELSVLCDA++ LIIFS+ GKL ++C+    M + ++R  K +   I  ++      E  + E   L+     LQ   R   GEDLG +   +L+QLE +L+ S+ +VR  K + +  QL +L+ KE+ML E N
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS-NMLKTLDRYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETN 165          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD57_ORYSJ (MADS-box transcription factor 57 OS=Oryza sativa subsp. japonica GN=MADS57 PE=2 SV=2)

HSP 1 Score: 128.642 bits (322), Expect = 5.819e-29
Identity = 72/169 (42.60%), Postives = 110/169 (65.09%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSRE-QIF-NELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYR 554
            MGRGKI I+RI+N T+RQVTFSKRR GLLKK  ELS+LCDA++GL++FSSTG+L ++ +    M+ +I+R        +  + + E +I+  E A LR++   LQ S ++  GE+L  +   DL  LE+ LE S+  +R RK+ LL+ +++ L  K  ++ +EN  + R
Sbjct:    1 MGRGKIVIRRIDNSTSRQVTFSKRRNGLLKKAKELSILCDAEVGLVVFSSTGRLYEFSST--NMKTVIDRYTNAKEELLGGNATSEIKIWQREAASLRQQLHNLQESHKQLMGEELSGLGVRDLQGLENRLEISLRNIRMRKDNLLKSEIEELHVKGSLIHQENIELSR 167          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD34_ORYSJ (MADS-box transcription factor 34 OS=Oryza sativa subsp. japonica GN=MADS34 PE=2 SV=2)

HSP 1 Score: 128.257 bits (321), Expect = 7.599e-29
Identity = 68/175 (38.86%), Postives = 108/175 (61.71%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKV----TGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQE 566
            MGRGK+ ++RIEN  +RQVTF+KRR GLLKK +ELS+LCDA++ L++FS  G+L Q+ +    M + +ER  +          P  D  +  + E   L+     LQ S R   GEDL  +  ++L+QLE ++  ++ ++R RK ++L  +L +L+RKE+ML++ N  + R + E
Sbjct:    1 MGRGKVVLQRIENKISRQVTFAKRRNGLLKKAYELSILCDAEVALVLFSHAGRLYQFSSSS-NMLKTLERYQRYIYASQDAAAPTSDEMQNNYQEYVNLKAHVEILQQSQRNLLGEDLAPLATNELEQLESQVVRTLKQIRSRKTQVLLDELCDLKRKEQMLQDANRVLKRKLDE 174          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MADS2_PETHY (Floral homeotic protein PMADS 2 OS=Petunia hybrida GN=PMADS2 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 9.925e-29
Identity = 71/208 (34.13%), Postives = 122/208 (58.65%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNM-YRWIQEHRAALEYQQAAMEAKPAEEHHHQVLDHFPFLGDQQP 674
            MGRGKI IKRIEN + RQVT+SKRR G++KK  E++VLCDA++ LIIF ++GK+ +YC+    +  +++   K +G R+ +    E + NE+  ++KE   +Q+ +R   GED+ S+ + +L  LE  L + ++ +  +++E+L+     +R+ +++LEEE+  + Y   Q+  AA+      +E    +          PF    QP
Sbjct:    1 MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLIIFGNSGKMHEYCSPSTTLPDMLDGYQKTSGRRLWD-AKHENLSNEIDRIKKENDNMQVKLRHLKGEDINSLNHKELMVLEEGLTNGLSSISAKQSEILRM----VRKNDQILEEEHKQLQYALHQKEMAAMGGNMRMIEEVYHQRDRDYEYQQMPFALRVQP 203          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AG_ARATH (Floral homeotic protein AGAMOUS OS=Arabidopsis thaliana GN=AG PE=1 SV=2)

HSP 1 Score: 127.872 bits (320), Expect = 9.925e-29
Identity = 79/207 (38.16%), Postives = 118/207 (57.00%), Query Frame = 3
Query:   33 EQEKIRIMGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKV----TGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKPAEEHHHQVL 641
            +   +R  GRGKI IKRIEN T RQVTF KRR GLLKK +ELSVLCDA++ LI+FSS G+L +Y      ++  IER  K     + T      + +    E A LR++   +Q S R+  GE +GS+   +L  LE  LE S+ ++R +KNELL  ++D ++++E  L  +N  +   I E+    E    ++   P   ++ Q++
Sbjct:   10 DSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN--SVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQNSNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKREVDLHNDNQILRAKIAEN----ERNNPSISLMPGGSNYEQLM 210          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL15_ARATH (Agamous-like MADS-box protein AGL15 OS=Arabidopsis thaliana GN=AGL15 PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 9.925e-29
Identity = 76/181 (41.99%), Postives = 107/181 (59.12%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDS-----REQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAAL 581
            MGRGKI IKRIEN  +RQVTFSKRR+GLLKK  ELSVLCDA++ +I+FS +GKL +Y +            +K T +R   H S      E+   E+ +L+ +  +LQ    +  G+ L  + + +L  LE +L  ++  VR+RK  LL  QL+  R KE+  E EN  + R +QE R+ L
Sbjct:    1 MGRGKIEIKRIENANSRQVTFSKRRSGLLKKARELSVLCDAEVAVIVFSKSGKLFEYSS----------TGMKQTLSRYGNHQSSSASKAEEDCAEVDILKDQLSKLQEKHLQLQGKGLNPLTFKELQSLEQQLYHALITVRERKERLLTNQLEESRLKEQRAELENETLRRQVQELRSFL 171          
The following BLAST results are available for this feature:
BLAST of DC900364 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
MAD21_ORYSJ3.411e-2939.18MADS-box transcription factor 21 OS=Oryza sativa s... [more]
AGL14_ARATH3.411e-2943.64Agamous-like MADS-box protein AGL14 OS=Arabidopsis... [more]
MTF1_PEA4.455e-2938.14MADS-box transcription factor 1 OS=Pisum sativum G... [more]
AG_PANGI4.455e-2941.30Floral homeotic protein AGAMOUS OS=Panax ginseng G... [more]
SEP1_ARATH5.819e-2943.37Developmental protein SEPALLATA 1 OS=Arabidopsis t... [more]
MAD57_ORYSJ5.819e-2942.60MADS-box transcription factor 57 OS=Oryza sativa s... [more]
MAD34_ORYSJ7.599e-2938.86MADS-box transcription factor 34 OS=Oryza sativa s... [more]
MADS2_PETHY9.925e-2934.13Floral homeotic protein PMADS 2 OS=Petunia hybrida... [more]
AG_ARATH9.925e-2938.16Floral homeotic protein AGAMOUS OS=Arabidopsis tha... [more]
AGL15_ARATH9.925e-2941.99Agamous-like MADS-box protein AGL15 OS=Arabidopsis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900364 VSS Citrus sinensis cDNA clone VS28932 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900364 ID=DC900364|Name=DC900364|organism=Citrus sinensis|type=EST|length=1050bp
CGGCACGAGTTACAAGCAAAGCAAGAGAAAGCGAACAAGAAAAGATCAGA
ATAATGGGACGTGGGAAGATAGCGATCAAGAGGATTGAGAACCCGACGAC
GAGGCAAGTAACCTTCTCGAAACGGAGAGCTGGGCTTTTGAAGAAGACCC
ATGAACTCTCAGTGCTTTGTGATGCTCAAATTGGCCTCATCATCTTCTCA
AGTACCGGAAAATTGTGCCAGTACTGCACTGAGCCTTTCAGAATGGAGCA
AATCATTGAGAGGCGCCTCAAAGTTACAGGGACTCGCATCCCTGAGCATG
ATAGCCGGGAACAAATATTCAATGAGTTGGCGGTTCTGAGAAAAGAAACC
CGCCGCCTTCAGCTGAGTATGCGACGCTACACTGGTGAGGACTTGGGTTC
TATACCTTATGATGATCTCGATCAACTTGAACATGAGCTTGAAAGCTCTG
TTAACAAGGTCCGAGATCGCAAGAATGAGCTTCTTCAACAACAGCTGGAT
AATCTTCGTAGGAAGGAGCGAATGCTGGAGGAAGAGAACAGCAACATGTA
CCGTTGGATTCAGGAGCATAGGGCAGCATTGGAGTATCAGCAAGCTGCAA
TGGAAGCAAAGCCAGCTGAGGAGCATCATCATCAAGTCTTGGATCATTTT
CCATTCTTGGGAGATCAACAACCCAGTAGTGTGCTTCAGCTTGCAACCAA
CAGTATCCCTCATCAAATTCACCCTTATCACCATCTTCAGCTTGCTCAGC
CCAACCTTCAGGATCCCAATGTCTAGTATCAGCTTAAGAAGGATGTCCGA
AAGAGGTTGCGAAAGAGTAGATGATATAATCATTATGAAGATGACTCATA
ATTATCTCCTGGTTATTAATTACCTTATATAGTTTGCAGTAATTAAATTA
TTATTTTATGTTTTAGAAGCTACGAATGATCTGCTCGCTATGTGTGTTCC
TCATATTTATAACTCTTTGTATATGTATTGAGATATGTGACTTCAAACAA
TTGTACTGTGGTATGTTTTAGACATGAAAAAGTACTTGAATTTCTGCCGT
back to top