DC900364

Overview
NameDC900364
Unique NameDC900364
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1050
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MADS1_PETHY (Floral homeotic protein PMADS 1 OS=Petunia hybrida GN=PMADS1 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.693e-28
Identity = 80/228 (35.09%), Postives = 131/228 (57.46%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKPAEEHHHQVLDHFPFLGDQQPSSVLQLATNSIPHQIHPYHHL 737
            M RGKI IKRIEN T RQVT+SKRR GL KK +EL+VLCDA++ +I+ SSTGKL ++ +     +Q+ +   K  G  +  +   E++  +L  L++  R L+  +R+  GE L  + Y+ L++L   +++S+  +R+RK +++  Q++  ++K R +EE + N+   + E  A  E     +E    E  ++ VL  FP  G +    +L L      HQ + +HHL
Sbjct:    1 MARGKIQIKRIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISPSITTKQLFDLYQKTVGVDL-WNSHYEKMQEQLRKLKEVNRNLRKEIRQRMGESLNDLNYEQLEELMENVDNSLKLIRERKYKVIGNQIETFKKKVRNVEEIHRNL---LLEFDARQEDPYGLVE---QEGDYNSVLG-FPNGGHR----ILALRLQPNHHQPNHHHHL 216          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MADS5_ORYSJ (MADS-box transcription factor 5 OS=Oryza sativa subsp. japonica GN=MADS5 PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 2.211e-28
Identity = 76/207 (36.71%), Postives = 117/207 (56.52%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELA------VLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKP---AEEHHHQVLDH 647
            MGRGK+ +KRIEN  +RQVTF+KRR GLLKK +ELSVLCDA++ LIIFS+ G+L ++ T     + +   R +     +   ++   +  EL+       L+     LQ + R   GEDL  +   +L+QLE+++E S+  +R  KN+ L  Q+  L+RKE+ L++ N ++ R IQE         +  +  P   A E + + L H
Sbjct:    1 MGRGKVELKRIENKISRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGRLFEFSTSSCMYKTL--ERYRSCNYNLNSCEASAALETELSNYQEYLKLKTRVEFLQTTQRNLLGEDLVPLSLKELEQLENQIEISLMNIRSSKNQQLLDQVFELKRKEQQLQDANKDLKRKIQETSGENMLHISCQDVGPSGHASEANQEFLHH 205          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MADS5_ORYSI (MADS-box transcription factor 5 OS=Oryza sativa subsp. indica GN=MADS5 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 2.211e-28
Identity = 76/207 (36.71%), Postives = 117/207 (56.52%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELA------VLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKP---AEEHHHQVLDH 647
            MGRGK+ +KRIEN  +RQVTF+KRR GLLKK +ELSVLCDA++ LIIFS+ G+L ++ T     + +   R +     +   ++   +  EL+       L+     LQ + R   GEDL  +   +L+QLE+++E S+  +R  KN+ L  Q+  L+RKE+ L++ N ++ R IQE         +  +  P   A E + + L H
Sbjct:    1 MGRGKVELKRIENKISRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGRLFEFSTSSCMYKTL--ERYRSCNYNLNSCEASAALETELSNYQEYLKLKTRVEFLQTTQRNLLGEDLVPLSLKELEQLENQIEISLMNIRSSKNQQLLDQVFELKRKEQQLQDANKDLKRKIQETSGENMLHISCQDVGPSGHASEANQEFLHH 205          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL9_SOLLC (Agamous-like MADS-box protein AGL9 homolog OS=Solanum lycopersicum GN=TDR5 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 2.211e-28
Identity = 73/176 (41.48%), Postives = 105/176 (59.66%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVT-GTRIPEHDSREQI----FNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQE 566
            MGRG++ +KRIE    RQVTF+KRR GLLKK +ELSVLCDA++ LIIFS+ GKL ++C+    M + +ER  K   G   P   +RE +      E   L+     LQ S R   GEDLG +   +L+ LE +L+ S+ ++R  + +L+  QL + +RKE  L E N  + + + E
Sbjct:    1 MGRGRVELKRIEGKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS-SMLKTLERYQKCNYGAPEPNISTREALEISSQQEYLKLKGRYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDYQRKEHALNEANRTLKQRLME 175          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD58_ORYSJ (MADS-box transcription factor 58 OS=Oryza sativa subsp. japonica GN=MADS58 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 3.771e-28
Identity = 82/231 (35.50%), Postives = 126/231 (54.55%), Query Frame = 3
Query:   48 RIMGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLK----VTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKPAEEHHHQVLDHFPFLGDQQPSSVLQLATNSIPHQIHPY 728
            +I  RGKI IKRIEN T RQVTF KRR+GLLKK +ELSVLCDA++ L++FSS G+L +Y      +++ IER  K     +        + +    E A L+++   LQ S R   G+++ ++ + +L QLE  L+  + K+R RKNELL  +++ ++R+E  L+ +N  +   + E    L  Q   M    +   + Q + H+       P + LQ    +I HQ   Y
Sbjct:   41 KIGSRGKIEIKRIENTTNRQVTFCKRRSGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSNN--SVKETIERYKKANSDTSNASTVAEINAQHYQQEAAKLKQQITNLQNSNRTLVGDNITTMNHRELKQLEGRLDKGLGKIRARKNELLCAEIEYMQRRETELQNDNMYLKSKVAESERGL--QTVNMMGSASTSEYVQNMIHY------DPRNFLQF---NIMHQPQYY 258          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD56_ORYSI (MADS-box transcription factor 56 OS=Oryza sativa subsp. indica GN=MADS56 PE=2 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 3.771e-28
Identity = 70/168 (41.67%), Postives = 106/168 (63.10%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPE---HDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNM 548
            M RG+  +KRIENPT+RQVTFSKRR GLLKK  ELSVLCDA++ LI+FS  G+L ++ + P  +++ I+R    T   +         +Q+ ++   L K+   L  S R+  GE+L     ++L  LE +LE S++ +R +K ELL++Q+  L+ KER L ++N N+
Sbjct:    1 MVRGRTELKRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGRLYEFASAP-SLQKTIDRYKAYTKDHVNNKTIQQDIQQVKDDTLGLAKKLEALDESRRKILGENLEGCSIEELRGLEMKLEKSLHNIRLKKTELLERQIAKLKEKERTLLKDNENL 167          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: GLOB_TOBAC (Floral homeotic protein GLOBOSA OS=Nicotiana tabacum GN=GLO PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 3.771e-28
Identity = 70/207 (33.82%), Postives = 124/207 (59.90%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKPAEEHHHQVLDHFPFLGDQQP 674
            MGRGKI IKRIEN + RQVT+SKRR G+LKK  E+SVLCDA++ +IIF+S+GK+ ++ +    +  I+++  K+TG R+ +    E + NE+  ++K+   +Q+ +R   GED+ S+ + +L  LE  L++ +  +R+++N+LL+     +R+K + +EEE   +   +++   A   +      +   +  ++     PF    QP
Sbjct:    1 MGRGKIEIKRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEFSST--SLVDILDQYHKLTGRRLWD-AKHENLDNEINKVKKDNDNMQIELRHLKGEDITSLNHRELMMLEDALDNGLTSIRNKQNDLLRM----MRKKTQSMEEEQDQLNWQLRQLEIASMNRNMGEIGEVFHQRENEYQTQMPFAFRVQP 200          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL15_BRANA (Agamous-like MADS-box protein AGL15 OS=Brassica napus GN=AGL15 PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 3.771e-28
Identity = 74/178 (41.57%), Postives = 105/178 (58.99%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTG--TRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAAL 581
            MGRGKI IKRIEN  +RQVTFSKRRAGLLKK HELSVLCDA++ +I+FS +GKL ++ +   +   +     +++     I      ++   E+ +L+ E   LQ       G+ L  +   +L  LE +L  S+  VR+RK  LL +QL+  R KE+  E EN  + R +QE R+ L
Sbjct:    1 MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSSTSMKKTLLRYGNYQISSDVPGINCKTENQEECTEVDLLKDEISMLQEKHLHMQGKPLNLLSLKELQHLEKQLNFSLISVRERKELLLTKQLEESRLKEQRAELENETLRRQVQELRSFL 178          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MADS3_ORYSJ (MADS-box transcription factor 3 OS=Oryza sativa subsp. japonica GN=MADS3 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 8.402e-28
Identity = 85/238 (35.71%), Postives = 130/238 (54.62%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFR--MEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQ-LSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMY---RWIQEHRAALEYQQAAMEAKPAEEHHHQVLDHFPFLGDQQPSSVLQLATNSIPHQIHPYHHLQLAQ 749
            MGRGKI IKRIEN T RQVTF KRR GLLKK +ELSVLCDA++ LI+FSS G+L +Y     +  +E+  +     + +      + +    E + LR++   LQ  + R   G+ + ++   DL Q+E+ LE  + K+R RKNELL  +++ ++++E  +E +N NMY   + ++  R   +     M A    E+ H V + +      Q + + Q       HQ+ P   LQL Q
Sbjct:    1 MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKSTVERYKKANSDTSNSGTVAEVNAQHYQQESSKLRQQISSLQNANSRTIVGDSINTMSLRDLKQVENRLEKGIAKIRARKNELLYAEVEYMQKRE--VELQNDNMYLRSKVVENERG--QQPLNMMGAASTSEYDHMVNNPYDSRNFLQVNIMQQ--PQHYAHQLQP-TTLQLGQ 231          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AG_PETHY (Floral homeotic protein AGAMOUS OS=Petunia hybrida GN=AG1 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 8.402e-28
Identity = 72/172 (41.86%), Postives = 105/172 (61.05%), Query Frame = 3
Query:   48 RIMGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKV----TGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMY 551
            R +GRGKI IKRIEN T RQVTF KRR GLLKK +ELSVLCDA++ LI+FSS G+L +Y      ++  IER  K     + T      + +    E + LR +   LQ   R + GE L ++   DL  LE ++E  ++K+R +KNELL  +++ ++++E  ++  N+N Y
Sbjct:   15 RKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN--SVKATIERYKKACSDSSNTGSIAEANAQYYQQEASKLRAQIGNLQNQNRNFLGESLAALNLRDLRNLEQKIEKGISKIRAKKNELLFAEIEYMQKRE--IDLHNNNQY 182          
The following BLAST results are available for this feature:
BLAST of DC900364 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
MADS1_PETHY1.693e-2835.09Floral homeotic protein PMADS 1 OS=Petunia hybrida... [more]
MADS5_ORYSJ2.211e-2836.71MADS-box transcription factor 5 OS=Oryza sativa su... [more]
MADS5_ORYSI2.211e-2836.71MADS-box transcription factor 5 OS=Oryza sativa su... [more]
AGL9_SOLLC2.211e-2841.48Agamous-like MADS-box protein AGL9 homolog OS=Sola... [more]
MAD58_ORYSJ3.771e-2835.50MADS-box transcription factor 58 OS=Oryza sativa s... [more]
MAD56_ORYSI3.771e-2841.67MADS-box transcription factor 56 OS=Oryza sativa s... [more]
GLOB_TOBAC3.771e-2833.82Floral homeotic protein GLOBOSA OS=Nicotiana tabac... [more]
AGL15_BRANA3.771e-2841.57Agamous-like MADS-box protein AGL15 OS=Brassica na... [more]
MADS3_ORYSJ8.402e-2835.71MADS-box transcription factor 3 OS=Oryza sativa su... [more]
AG_PETHY8.402e-2841.86Floral homeotic protein AGAMOUS OS=Petunia hybrida... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900364 VSS Citrus sinensis cDNA clone VS28932 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900364 ID=DC900364|Name=DC900364|organism=Citrus sinensis|type=EST|length=1050bp
CGGCACGAGTTACAAGCAAAGCAAGAGAAAGCGAACAAGAAAAGATCAGA
ATAATGGGACGTGGGAAGATAGCGATCAAGAGGATTGAGAACCCGACGAC
GAGGCAAGTAACCTTCTCGAAACGGAGAGCTGGGCTTTTGAAGAAGACCC
ATGAACTCTCAGTGCTTTGTGATGCTCAAATTGGCCTCATCATCTTCTCA
AGTACCGGAAAATTGTGCCAGTACTGCACTGAGCCTTTCAGAATGGAGCA
AATCATTGAGAGGCGCCTCAAAGTTACAGGGACTCGCATCCCTGAGCATG
ATAGCCGGGAACAAATATTCAATGAGTTGGCGGTTCTGAGAAAAGAAACC
CGCCGCCTTCAGCTGAGTATGCGACGCTACACTGGTGAGGACTTGGGTTC
TATACCTTATGATGATCTCGATCAACTTGAACATGAGCTTGAAAGCTCTG
TTAACAAGGTCCGAGATCGCAAGAATGAGCTTCTTCAACAACAGCTGGAT
AATCTTCGTAGGAAGGAGCGAATGCTGGAGGAAGAGAACAGCAACATGTA
CCGTTGGATTCAGGAGCATAGGGCAGCATTGGAGTATCAGCAAGCTGCAA
TGGAAGCAAAGCCAGCTGAGGAGCATCATCATCAAGTCTTGGATCATTTT
CCATTCTTGGGAGATCAACAACCCAGTAGTGTGCTTCAGCTTGCAACCAA
CAGTATCCCTCATCAAATTCACCCTTATCACCATCTTCAGCTTGCTCAGC
CCAACCTTCAGGATCCCAATGTCTAGTATCAGCTTAAGAAGGATGTCCGA
AAGAGGTTGCGAAAGAGTAGATGATATAATCATTATGAAGATGACTCATA
ATTATCTCCTGGTTATTAATTACCTTATATAGTTTGCAGTAATTAAATTA
TTATTTTATGTTTTAGAAGCTACGAATGATCTGCTCGCTATGTGTGTTCC
TCATATTTATAACTCTTTGTATATGTATTGAGATATGTGACTTCAAACAA
TTGTACTGTGGTATGTTTTAGACATGAAAAAGTACTTGAATTTCTGCCGT
back to top