DC900364

Overview
NameDC900364
Unique NameDC900364
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1050
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD23_ORYSJ (MADS-box transcription factor 23 OS=Oryza sativa subsp. japonica GN=MADS23 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 7.113e-27
Identity = 69/157 (43.95%), Postives = 98/157 (62.42%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIER--RLKVTGTRIPEHDSREQIF-NELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRK 515
            MGRGKI IKRI+N T+RQVTFSKRR+GL KK  ELS+LCDA++GL++FSST +L  + +    M+ IIER    K    +     S  +++  E A LR++   LQ   R+  G+ L  +  +DL  LE +LE S+  +R RK+ ++  Q+  L RK
Sbjct:    1 MGRGKIEIKRIDNATSRQVTFSKRRSGLFKKARELSILCDAEVGLLVFSSTSRLYDFASS--SMKSIIERYNETKEDPHQTMNASSEAKLWQQEAASLRQQLHNLQEYHRQLLGQQLSGLDVEDLQNLESKLEMSLKNIRLRKDNVMMDQIQELSRK 155          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL12_ARATH (Agamous-like MADS-box protein AGL12 OS=Arabidopsis thaliana GN=AGL12 PE=2 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 1.213e-26
Identity = 77/196 (39.29%), Postives = 117/196 (59.69%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVT----GTRIPEHDSREQI-------FNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQE-HRAALEYQQAAME 605
            M RGKI +KRIENP  RQVTF KRR GLLKK  ELSVLCDA+IG++IFS  GKL +  T+   ME +I++ +K T    G+      ++EQ+        +E+ VL++E   LQ  +    G   G++  ++L  LE  LE  ++++R  K +++ Q++ +LR KE +L+  N  +   I+E + + L+   A ME
Sbjct:    1 MARGKIQLKRIENPVHRQVTFCKRRTGLLKKAKELSVLCDAEIGVVIFSPQGKLFELATKG-TMEGMIDKYMKCTGGGRGSSSATFTAQEQLQPPNLDPKDEINVLKQEIEMLQKGISYMFGGGDGAMNLEELLLLEKHLEYWISQIRSAKMDVMLQEIQSLRNKEGVLKNTNKYLLEKIEENNNSILDANFAVME 195          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: JOIN_SOLLC (MADS-box protein JOINTLESS OS=Solanum lycopersicum GN=J PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 2.069e-26
Identity = 74/175 (42.29%), Postives = 104/175 (59.43%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERR-LKVTGTRIPEHDSREQIFNE---LAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQE 566
            M R KI IK+I+N T RQVTFSKRR GL KK  ELSVLCDA + LIIFSSTGKL  Y +    M+QI+ERR L        +  S E    E    + L KE       +R+  GE+L  +  ++L QLE  LE+ +++V +RK + + ++++ L++K   L EEN  + + + E
Sbjct:    1 MAREKIQIKKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYSSS--SMKQILERRDLHSKNLEKLDQPSLELQLVENSNYSRLSKEISEKSHRLRQMRGEELQGLNIEELQQLERSLETGLSRVIERKGDKIMREINQLQQKGMHLMEENEKLRQQVME 173          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD47_ORYSJ (MADS-box transcription factor 47 OS=Oryza sativa subsp. japonica GN=MADS47 PE=1 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 3.530e-26
Identity = 71/175 (40.57%), Postives = 102/175 (58.29%), Query Frame = 3
Query:   60 RGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNE----LAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHR 572
            R +IAI+RI+N   RQVTFSKRR GL KK  ELS+LCDA++GL++FS+TGKL Q+ +    MEQII+R    + T      S+  +  E     A L++E     L +R+  GE+L  +  + L +LE  LES +  V   K++ +  ++D L RK   L EEN  +   +Q  R
Sbjct:   22 RERIAIRRIDNLAARQVTFSKRRRGLFKKAEELSILCDAEVGLVVFSATGKLFQFAST--SMEQIIDRYNSHSKTLQRAEPSQLDLQGEDSSTCARLKEELAETSLRLRQMRGEELHRLNVEQLQELEKSLESGLGSVLKTKSKKILDEIDGLERKRMQLIEENLRLKEQLQVSR 194          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL17_ARATH (Agamous-like MADS-box protein AGL17 OS=Arabidopsis thaliana GN=AGL17 PE=2 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 3.530e-26
Identity = 72/202 (35.64%), Postives = 119/202 (58.91%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIER--RLKVTGTRIPEHDSREQIF-NELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQE-HRAALE-YQQAAMEAKPAEEHHHQVLD 644
            MGRGKI I++I++ T+RQVTFSKRR GL+KK  EL++LCDA++ LIIFS+T KL  + +    ++  IER    K+    +    S  + +  E   LR+E   LQ + R+ TG +L  +   +L  +E +LE S+  +R ++ ++L  ++  L RK  ++  EN  + R +Q  H+  +E Y++A   +      HH+++D
Sbjct:    1 MGRGKIVIQKIDDSTSRQVTFSKRRKGLIKKAKELAILCDAEVCLIIFSNTDKLYDFASS--SVKSTIERFNTAKMEEQELMNPASEVKFWQREAETLRQELHSLQENYRQLTGVELNGLSVKELQNIESQLEMSLRGIRMKREQILTNEIKELTRKRNLVHHENLELSRKVQRIHQENVELYKKAYGTSNTNGLGHHELVD 200          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD20_ORYSJ (MADS-box transcription factor 20 OS=Oryza sativa subsp. japonica GN=MADS20 PE=2 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 4.610e-26
Identity = 65/165 (39.39%), Postives = 98/165 (59.39%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIER----RLKVTGTRIPEH--DSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLE 530
            MGRGK+ ++RIEN  +RQVTFSKRR GLLKK HE++VLCD  +  I+FS+ G L  Y +    ME+I+E+     L   G  + E   +    +  +   LR     L+ S R   G++L S+   D+ QLE+++++S+N +R RK +LL ++   L +K   LE
Sbjct:    1 MGRGKVQVRRIENEVSRQVTFSKRRPGLLKKAHEIAVLCDVDVAAIVFSAKGNLFHYASSHTTMERILEKYDRHELLSEGNNVIEEFPELEGSMSYDHIKLRGRIEALKKSQRNLMGQELDSLTLQDIQQLENQIDTSLNNIRSRKEKLLMEKNTILEKKITELE 165          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD26_ORYSJ (MADS-box transcription factor 26 OS=Oryza sativa subsp. japonica GN=MADS26 PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.136e-24
Identity = 71/179 (39.66%), Postives = 101/179 (56.42%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPE-HDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGS-IPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALE 584
            M RGK+ ++RIENP  RQVTF KRRAGLLKK  ELS+LC+A IG+IIFS+ GKL    T    ME++IER    +G +     D R     E  VL++E   LQ  +R   G      +  ++L+ LE  LE  +  +R  K +++ Q++  L+ KE ML+  N  +   I E    ++
Sbjct:    1 MARGKVQLRRIENPVHRQVTFCKRRAGLLKKARELSILCEADIGIIIFSAHGKLYDLATTG-TMEELIERYKSASGEQANACGDQRMDPKQEAMVLKQEINLLQKGLRYIYGNRANEHMTVEELNALERYLEIWMYNIRSAKMQIMIQEIQALKSKEGMLKAANEILQEKIVEQNGLID 178          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD26_ORYSI (MADS-box transcription factor 26 OS=Oryza sativa subsp. indica GN=MADS26 PE=2 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 1.136e-24
Identity = 71/179 (39.66%), Postives = 101/179 (56.42%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPE-HDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGS-IPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALE 584
            M RGK+ ++RIENP  RQVTF KRRAGLLKK  ELS+LC+A IG+IIFS+ GKL    T    ME++IER    +G +     D R     E  VL++E   LQ  +R   G      +  ++L+ LE  LE  +  +R  K +++ Q++  L+ KE ML+  N  +   I E    ++
Sbjct:    1 MARGKVQLRRIENPVHRQVTFCKRRAGLLKKARELSILCEADIGIIIFSAHGKLYDLATTG-TMEELIERYKSASGEQANACGDQRMDPKQEAMVLKQEINLLQKGLRYIYGNRANEHMTVEELNALERYLEIWMYNIRSAKMQIMIQEIQALKSKEGMLKAANEILQEKIVEQNGLID 178          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: SVP_ARATH (MADS-box protein SVP OS=Arabidopsis thaliana GN=SVP PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 2.530e-24
Identity = 66/169 (39.05%), Postives = 101/169 (59.76%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIER-RLKVTGTRIPEHDSREQIF---NELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNM 548
            M R KI I++I+N T RQVTFSKRR GL KK  ELSVLCDA + LIIFSSTGKL ++C+    M++++ER  L+       +  S E      ++ A + KE       +R+  GE+L  +  ++L QLE  LE+ + +V + K++ +  ++  L++K   L +EN  +
Sbjct:    1 MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS--SMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLDIEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRL 167          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD22_ORYSJ (MADS-box transcription factor 22 OS=Oryza sativa subsp. japonica GN=MADS22 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 2.530e-24
Identity = 77/221 (34.84%), Postives = 116/221 (52.49%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIER----RLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKPAEEHHHQVLDHFPFLGDQQPSSVLQLATNS 704
            M R +  IKRIE+   RQVTFSKRR GL KK  ELSVLCDA + LI+FSSTGKL  + +    M +II++       +     P  D   +  ++ A L ++     L +R+  GE+L  +  D+L QLE  LE+ +++V   K++   +Q+  L+RK   L EEN             ++ +    +  PAE+   QV+D   F+ + Q S  +  A +S
Sbjct:    1 MARERREIKRIESAAARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLSHFASS--SMNEIIDKYNTHSNNLGKAEQPSLDLNLE-HSKYAHLNEQLAEASLRLRQMRGEELEGLSIDELQQLEKNLEAGLHRVMLTKDQQFMEQISELQRKSSQLAEEN-------------MQLRNQVSQISPAEK---QVVDTENFVTEGQSSESVMTALHS 202          
The following BLAST results are available for this feature:
BLAST of DC900364 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
MAD23_ORYSJ7.113e-2743.95MADS-box transcription factor 23 OS=Oryza sativa s... [more]
AGL12_ARATH1.213e-2639.29Agamous-like MADS-box protein AGL12 OS=Arabidopsis... [more]
JOIN_SOLLC2.069e-2642.29MADS-box protein JOINTLESS OS=Solanum lycopersicum... [more]
MAD47_ORYSJ3.530e-2640.57MADS-box transcription factor 47 OS=Oryza sativa s... [more]
AGL17_ARATH3.530e-2635.64Agamous-like MADS-box protein AGL17 OS=Arabidopsis... [more]
MAD20_ORYSJ4.610e-2639.39MADS-box transcription factor 20 OS=Oryza sativa s... [more]
MAD26_ORYSJ1.136e-2439.66MADS-box transcription factor 26 OS=Oryza sativa s... [more]
MAD26_ORYSI1.136e-2439.66MADS-box transcription factor 26 OS=Oryza sativa s... [more]
SVP_ARATH2.530e-2439.05MADS-box protein SVP OS=Arabidopsis thaliana GN=SV... [more]
MAD22_ORYSJ2.530e-2434.84MADS-box transcription factor 22 OS=Oryza sativa s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900364 VSS Citrus sinensis cDNA clone VS28932 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900364 ID=DC900364|Name=DC900364|organism=Citrus sinensis|type=EST|length=1050bp
CGGCACGAGTTACAAGCAAAGCAAGAGAAAGCGAACAAGAAAAGATCAGA
ATAATGGGACGTGGGAAGATAGCGATCAAGAGGATTGAGAACCCGACGAC
GAGGCAAGTAACCTTCTCGAAACGGAGAGCTGGGCTTTTGAAGAAGACCC
ATGAACTCTCAGTGCTTTGTGATGCTCAAATTGGCCTCATCATCTTCTCA
AGTACCGGAAAATTGTGCCAGTACTGCACTGAGCCTTTCAGAATGGAGCA
AATCATTGAGAGGCGCCTCAAAGTTACAGGGACTCGCATCCCTGAGCATG
ATAGCCGGGAACAAATATTCAATGAGTTGGCGGTTCTGAGAAAAGAAACC
CGCCGCCTTCAGCTGAGTATGCGACGCTACACTGGTGAGGACTTGGGTTC
TATACCTTATGATGATCTCGATCAACTTGAACATGAGCTTGAAAGCTCTG
TTAACAAGGTCCGAGATCGCAAGAATGAGCTTCTTCAACAACAGCTGGAT
AATCTTCGTAGGAAGGAGCGAATGCTGGAGGAAGAGAACAGCAACATGTA
CCGTTGGATTCAGGAGCATAGGGCAGCATTGGAGTATCAGCAAGCTGCAA
TGGAAGCAAAGCCAGCTGAGGAGCATCATCATCAAGTCTTGGATCATTTT
CCATTCTTGGGAGATCAACAACCCAGTAGTGTGCTTCAGCTTGCAACCAA
CAGTATCCCTCATCAAATTCACCCTTATCACCATCTTCAGCTTGCTCAGC
CCAACCTTCAGGATCCCAATGTCTAGTATCAGCTTAAGAAGGATGTCCGA
AAGAGGTTGCGAAAGAGTAGATGATATAATCATTATGAAGATGACTCATA
ATTATCTCCTGGTTATTAATTACCTTATATAGTTTGCAGTAATTAAATTA
TTATTTTATGTTTTAGAAGCTACGAATGATCTGCTCGCTATGTGTGTTCC
TCATATTTATAACTCTTTGTATATGTATTGAGATATGTGACTTCAAACAA
TTGTACTGTGGTATGTTTTAGACATGAAAAAGTACTTGAATTTCTGCCGT
back to top