DC900364

Overview
NameDC900364
Unique NameDC900364
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1050
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: FLC_ARATH (MADS-box protein FLOWERING LOCUS C OS=Arabidopsis thaliana GN=FLC PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 3.304e-24
Identity = 72/201 (35.82%), Postives = 115/201 (57.21%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQ-EHRAALEYQQAAMEAKPAEEHHHQVLDHFP 653
            MGR K+ IKRIEN ++RQVTFSKRR GL++K  +LSVLCDA + L++ S++GKL  + +    + +I++R  K     +   D + +  N           L+L   +  G ++ ++  D L QLE  LE++++  R +K EL+ + ++NL+ KE+ML+EEN  +   ++  H    E   A ME  PA     Q+ D+ P
Sbjct:    1 MGRKKLEIKRIENKSSRQVTFSKRRNGLIEKARQLSVLCDASVALLVVSASGKLYSFSSGD-NLVKILDRYGKQHADDLKALDHQSKALN----YGSHYELLELVDSKLVGSNVKNVSIDALVQLEEHLETALSVTRAKKTELMLKLVENLKEKEKMLKEENQVLASQMENNHHVGAE---AEMEMSPA----GQISDNLP 189          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AP3_ARATH (Floral homeotic protein APETALA 3 OS=Arabidopsis thaliana GN=AP3 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 1.256e-23
Identity = 68/216 (31.48%), Postives = 115/216 (53.24%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQ---------------EHRAALEYQ---QAAMEAKPAEEHHHQVLDH 647
            M RGKI IKRIEN T RQVT+SKRR GL KK HEL+VLCDA++ +I+FSS+ KL +Y +     ++I++    ++   +      E++      L +  R L+  +++  GE L  +   +L +LE E+E++   VR+RK + L  Q++  ++K +  ++   N+   ++               ++ + L YQ     A   +  + HHH   +H
Sbjct:    1 MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISPNTTTKEIVDLYQTISDVDV-WATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQELRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLVDNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNH 215          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: CMB2_DIACA (MADS-box protein CMB2 OS=Dianthus caryophyllus GN=CMB2 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 5.275e-22
Identity = 57/167 (34.13%), Postives = 100/167 (59.88%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRI--PEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNM 548
            MGRGK+ I++IEN T RQVTFSKRR G++KK  EL+VLCDA++ L++ SST KL  Y +    ++++ +   K+ G  +   + +  ++   ++  L    RR    + R  G DL  +   +L  L+ E+E ++ ++R++K   ++ Q    R+K + LEE ++++
Sbjct:    1 MGRGKLEIRKIENKTNRQVTFSKRRNGIMKKAQELTVLCDAKVSLLMISSTHKLHHYLSPGVSLKKMYDEYQKIEGVDLWRKQWERMQEQHRKVLELNSLLRR---EISRRMGGDLEGLTLVELSALQQEMEEAIIQIRNKKYHTIKNQTGTTRKKIKNLEERHTDL 164          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD55_ORYSJ (MADS-box transcription factor 55 OS=Oryza sativa subsp. japonica GN=MADS55 PE=2 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 6.448e-20
Identity = 61/192 (31.77%), Postives = 97/192 (50.52%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQI---------------------------FNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNM 548
            M R +  I+RIE+   RQVTFSKRR GL KK  EL+VLCDA + L++FSSTGKL Q+ +    M +II+ +       + + D +  I                            ++ + L ++     L +R+  GE+L  +  ++L Q+E  LE+ + +V   K++   Q++  L+RK   L EEN  +
Sbjct:    1 MARERREIRRIESAAARQVTFSKRRRGLFKKAEELAVLCDADVALVVFSSTGKLSQFASS--NMNEIID-KYTTHSKNLGKTDKQPSIDLNFFLIILLRTYTNSYAYIHLLLQLEHSKCSSLNEQLAEASLQLRQMRGEELEGLSVEELQQMEKNLEAGLQRVLCTKDQQFMQEISELQRKGIQLAEENMRL 189          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AGL31_ARATH (Agamous-like MADS-box protein AGL31 OS=Arabidopsis thaliana GN=AGL31 PE=2 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 6.448e-20
Identity = 61/165 (36.97%), Postives = 97/165 (58.79%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNM 548
            MGR K+ IKRIEN ++RQVTFSKRR GL++K  +LS+LC++ I +++ S +GKL +  +    M +II+R        +   D  E+  N L +  KE   +  S    +  D  S+  D L  LE +LE++++  R RK EL+  ++ +L++ E +L EEN  +
Sbjct:    1 MGRKKVEIKRIENKSSRQVTFSKRRNGLIEKARQLSILCESSIAVLVVSGSGKLYKSASGD-NMSKIIDRYEIHHADELEALDLAEKTRNYLPL--KELLEIVQSKLEESNVDNASV--DTLISLEEQLETALSVTRARKTELMMGEVKSLQKTENLLREENQTL 160          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD32_ORYSJ (MADS-box transcription factor 32 OS=Oryza sativa subsp. japonica GN=MADS32 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.100e-19
Identity = 62/162 (38.27%), Postives = 92/162 (56.79%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPF-RMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEE 536
            MGRG+  IKRIENPT RQ TF KRR GL KK  EL+VLCDA + L++FS++GKL  + +     + + +ER    T T++   D R++   EL  +      L+  +R  T +D        L+ LEH LE+++ KVR  K+  +  ++  L+   R  +EE
Sbjct:    1 MGRGRSEIKRIENPTQRQSTFYKRRDGLFKKARELAVLCDADLLLLLFSASGKLYHFLSPTVPSVREFVERYEATTHTKV-WADIRQERRAELEKVGSMCDLLEKQLRFMTVDDGEEYTVPSLEALEHNLEAAMRKVRSEKDRKIGGEICYLQNIIRGRQEE 161          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MEF2C_PIG (Myocyte-specific enhancer factor 2C OS=Sus scrofa GN=MEF2C PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.624e-13
Identity = 48/100 (48.00%), Postives = 64/100 (64.00%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETR 353
            MGR KI I RI +   RQVTF+KR+ GL+KK +ELSVLCD +I LIIF+ST KL QY +    M++++   LK T    P H+SR       A+ +KE +
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTD--MDKVL---LKYTEYNEP-HESRTNSDIVEALNKKENK 94          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MEF2C_PONAB (Myocyte-specific enhancer factor 2C OS=Pongo abelii GN=MEF2C PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 4.476e-13
Identity = 45/85 (52.94%), Postives = 58/85 (68.24%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSR 308
            MGR KI I RI +   RQVTF+KR+ GL+KK +ELSVLCD +I LIIF+ST KL QY +    M++++   LK T    P H+SR
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTD--MDKVL---LKYTEYNEP-HESR 79          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MEF2C_MOUSE (Myocyte-specific enhancer factor 2C OS=Mus musculus GN=Mef2c PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 4.476e-13
Identity = 45/85 (52.94%), Postives = 58/85 (68.24%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSR 308
            MGR KI I RI +   RQVTF+KR+ GL+KK +ELSVLCD +I LIIF+ST KL QY +    M++++   LK T    P H+SR
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTD--MDKVL---LKYTEYNEP-HESR 79          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MEF2C_HUMAN (Myocyte-specific enhancer factor 2C OS=Homo sapiens GN=MEF2C PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 4.476e-13
Identity = 45/85 (52.94%), Postives = 58/85 (68.24%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSR 308
            MGR KI I RI +   RQVTF+KR+ GL+KK +ELSVLCD +I LIIF+ST KL QY +    M++++   LK T    P H+SR
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTD--MDKVL---LKYTEYNEP-HESR 79          
The following BLAST results are available for this feature:
BLAST of DC900364 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
FLC_ARATH3.304e-2435.82MADS-box protein FLOWERING LOCUS C OS=Arabidopsis ... [more]
AP3_ARATH1.256e-2331.48Floral homeotic protein APETALA 3 OS=Arabidopsis t... [more]
CMB2_DIACA5.275e-2234.13MADS-box protein CMB2 OS=Dianthus caryophyllus GN=... [more]
MAD55_ORYSJ6.448e-2031.77MADS-box transcription factor 55 OS=Oryza sativa s... [more]
AGL31_ARATH6.448e-2036.97Agamous-like MADS-box protein AGL31 OS=Arabidopsis... [more]
MAD32_ORYSJ1.100e-1938.27MADS-box transcription factor 32 OS=Oryza sativa s... [more]
MEF2C_PIG2.624e-1348.00Myocyte-specific enhancer factor 2C OS=Sus scrofa ... [more]
MEF2C_PONAB4.476e-1352.94Myocyte-specific enhancer factor 2C OS=Pongo abeli... [more]
MEF2C_MOUSE4.476e-1352.94Myocyte-specific enhancer factor 2C OS=Mus musculu... [more]
MEF2C_HUMAN4.476e-1352.94Myocyte-specific enhancer factor 2C OS=Homo sapien... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900364 VSS Citrus sinensis cDNA clone VS28932 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900364 ID=DC900364|Name=DC900364|organism=Citrus sinensis|type=EST|length=1050bp
CGGCACGAGTTACAAGCAAAGCAAGAGAAAGCGAACAAGAAAAGATCAGA
ATAATGGGACGTGGGAAGATAGCGATCAAGAGGATTGAGAACCCGACGAC
GAGGCAAGTAACCTTCTCGAAACGGAGAGCTGGGCTTTTGAAGAAGACCC
ATGAACTCTCAGTGCTTTGTGATGCTCAAATTGGCCTCATCATCTTCTCA
AGTACCGGAAAATTGTGCCAGTACTGCACTGAGCCTTTCAGAATGGAGCA
AATCATTGAGAGGCGCCTCAAAGTTACAGGGACTCGCATCCCTGAGCATG
ATAGCCGGGAACAAATATTCAATGAGTTGGCGGTTCTGAGAAAAGAAACC
CGCCGCCTTCAGCTGAGTATGCGACGCTACACTGGTGAGGACTTGGGTTC
TATACCTTATGATGATCTCGATCAACTTGAACATGAGCTTGAAAGCTCTG
TTAACAAGGTCCGAGATCGCAAGAATGAGCTTCTTCAACAACAGCTGGAT
AATCTTCGTAGGAAGGAGCGAATGCTGGAGGAAGAGAACAGCAACATGTA
CCGTTGGATTCAGGAGCATAGGGCAGCATTGGAGTATCAGCAAGCTGCAA
TGGAAGCAAAGCCAGCTGAGGAGCATCATCATCAAGTCTTGGATCATTTT
CCATTCTTGGGAGATCAACAACCCAGTAGTGTGCTTCAGCTTGCAACCAA
CAGTATCCCTCATCAAATTCACCCTTATCACCATCTTCAGCTTGCTCAGC
CCAACCTTCAGGATCCCAATGTCTAGTATCAGCTTAAGAAGGATGTCCGA
AAGAGGTTGCGAAAGAGTAGATGATATAATCATTATGAAGATGACTCATA
ATTATCTCCTGGTTATTAATTACCTTATATAGTTTGCAGTAATTAAATTA
TTATTTTATGTTTTAGAAGCTACGAATGATCTGCTCGCTATGTGTGTTCC
TCATATTTATAACTCTTTGTATATGTATTGAGATATGTGACTTCAAACAA
TTGTACTGTGGTATGTTTTAGACATGAAAAAGTACTTGAATTTCTGCCGT
back to top