DC900363

Overview
NameDC900363
Unique NameDC900363
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1374
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900363_ssr1068 microsatellite DC900363_ssr1068:1068..1083. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7102 contig Csv1_Contig7102:114..1481. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI5_PHAVU (Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 4.890e-45
Identity = 92/242 (38.02%), Postives = 130/242 (53.72%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F+     RN     A GF+ Y +FI A   Y    FG TG    + +EI AFL     +T+ G+  A  GP AWG C+  E +PS +YC  + ++  PC PG +YYGRG I I WNYNYG  G A+  DLLN P+ +  ++ ++F++A+W WMT  +  +PS+HD     W P+  D  ++R P +GT  NI+ G   CG+G    + + +  +  Y DLLGVG         L C  Q  F
Sbjct:   84 FDQVLKHRNDGACPAKGFYTYDAFIAAAKAYP--SFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRERNPS-AYCSATPQF--PCAPGQQYYGRGPIQISWNYNYGQCGRAIGVDLLNKPDLVATDSVISFKSALWFWMT-AQSPKPSSHDVITSRWTPSSADVAARRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFFKRYCDLLGVGY-----GNNLDCYSQTPF 314          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI1_TOBAC (Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1 SV=2)

HSP 1 Score: 182.57 bits (462), Expect = 4.890e-45
Identity = 89/242 (36.78%), Postives = 129/242 (53.31%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F+     RN       GF+ Y +FI A   +   GFGT+G    + +EI AF A    +T+ G+  A  GP AWG C+  E      YC  S ++  PC PG +Y+GRG I I  NYNYG  G A+  DLLN+P+ +  +  ++F++A+W WMTP +  +PS HD  +G W+P+  D  + R P FG   NI+ G   CG+G    + + +  Y  Y  +LGV      P + L C  Q++F
Sbjct:   89 FDQMLKHRNDNACQGKGFYSYNAFINAARSFP--GFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTPSGQW--PCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSALWFWMTP-QSPKPSCHDVIIGRWQPSAGDRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRYCSILGV-----SPGDNLDCGNQRSF 320          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI2_TOBAC (Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 6.386e-45
Identity = 89/242 (36.78%), Postives = 129/242 (53.31%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F+     RN       GF+ Y +FI A   +   GFGT+G    + +EI AF A    +T+ G+  A  GP AWG C+  E      YC  S ++  PC PG +Y+GRG I I  NYNYG  G A+  DLLN+P+ +  +  ++F++A+W WMTP +  +PS HD  +G W+P+  D  + R P FG   NI+ G   CG+G    + + +  Y  Y  +LGV      P + L C  Q++F
Sbjct:   84 FDQMLKHRNDNACQGKGFYSYNAFINAARSFP--GFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTPSGQW--PCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSALWFWMTP-QSPKPSCHDVIIGRWQPSSADRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRYCSILGV-----SPGDNLDCGNQRSF 315          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI2_GOSHI (Endochitinase 2 (Fragment) OS=Gossypium hirsutum PE=2 SV=2)

HSP 1 Score: 181.8 bits (460), Expect = 8.341e-45
Identity = 92/243 (37.86%), Postives = 129/243 (53.09%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYG-VATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F      RN     A GF+ Y +FI A   +    F TTG +  + +EI AFLA    +T+ G G  A  GP AWG CYN E++P  SYC     Y  PC PG +Y+GRG + + WNYNYG  G A+  DLLN+P+ +  + T++F++A W WMTP +  +PS H+  +G W P+ +D  + R   +G   NI+ G   CG+G    + + +  Y  Y D+LGV          L C  Q  F
Sbjct:   61 FNQMLLHRNDGACPARGFYTYDAFIAAARSFP--AFATTGDQATRKREIAAFLAQTSHETTGGAGWAAPDGPYAWGYCYNRELNPPSSYCASDPNY--PCAPGKQYFGRGPMQLSWNYNYGQCGRAIGVDLLNNPDLLSSDPTISFKSAFWFWMTP-QSPKPSCHNVIIGAWSPSSSDRAAGRATGYGVITNIINGGLECGKGWNAQVEDRIGFYKRYCDILGVSY-----GNNLDCYNQSPF 293          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI9_ORYSJ (Chitinase 9 OS=Oryza sativa subsp. japonica GN=Cht9 PE=2 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 1.858e-44
Identity = 89/243 (36.63%), Postives = 129/243 (53.09%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFN 996
            FE     RN     A GF+ Y + +TA   +    F  TG    + +E+ AFL     +T+ G+  A  GP +WG C+  E+  + SYC  S ++  PC P  +Y+GRG I + +NYNYG  GEA+  DLLN+PE +  +  ++F+ A+W WMTP +  +PS HD   G W P+  D  + R P +G   NI+ G   CG G  D + N +  Y  Y D+LG+G         L C +Q+ FN
Sbjct:   95 FEQLLLHRNDAACPARGFYTYDALVTAAAAFPD--FAATGDDEARKREVAAFLGQTSHETTGGWATAPDGPYSWGYCFKEEIGATASYCVPSAEW--PCAPDKKYFGRGPIQLSYNYNYGPAGEAIGEDLLNNPELVASDPVVSFKTALWFWMTP-QSPKPSCHDVITGQWTPSSGDIAAGRVPGYGVITNIINGGLECGFGPDDRVANRIGFYQRYCDVLGIGY-----GSNLDCYDQRPFN 327          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIC_SOLLC (Basic 30 kDa endochitinase OS=Solanum lycopersicum GN=CHI9 PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 4.140e-44
Identity = 92/243 (37.86%), Postives = 129/243 (53.09%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVG-FWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F+   + RN         F+ Y +F+TA   +   GFGTTG    + +EI AFLA    +T+ G+  A  GP AWG C+  E      YC  S ++  PC PG +Y+GRG I I  NYNYG  G A+  DLLN+P+ +  +  ++F++AIW WMTP +  +PS HD   G W+P+  D  + R P FG   NI+ G   CG G    + + +  Y  Y  +LGV      P E L C  Q++F
Sbjct:   81 FDQMLNHRNDNACQGKNNFYSYNAFVTAAGSFP--GFGTTGDITARKREIAAFLAQTSHETTGGWPTAPDGPYAWGYCFLREQGSPGDYCTPSSQW--PCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSAIWFWMTP-QSPKPSCHDVITGRWQPSGADQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGFYRRYCGILGV-----SPGENLDCGNQRSF 313          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI8_POPTR (Endochitinase WIN8 OS=Populus trichocarpa GN=WIN8 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 4.140e-44
Identity = 93/270 (34.44%), Postives = 129/270 (47.78%), Query Frame = 1
Query:  205 CPTWSKFCCNETISD----YFQVYQFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFNPN 1002
            C     +CC   +S     +F    FE     RN       GF+ Y ++  AT  Y   GFG TG    + +E+ AF A    +TS    +    P  WG C  +E++P+  YCD   K +YPC   A+YYGRG + + WNYNYG  G  L  +LL+ PE +  +  L+FEAA+W WM P     PS H+   G W P++ D  + R P FG   NI+     C +       N + +YL Y D+L     Q  P + L C  Q+ F  N
Sbjct:   47 CGLTVAYCCAGCVSQCRNCFFTESMFEQMLPNRNNDSCPGKGFYTYDAYFVATEFYP--GFGMTGDDDTRKRELAAFFAQTSQETSGRSIIGEDAPFTWGYCLVNELNPNSDYCDPKTKSSYPCV--ADYYGRGPLQLRWNYNYGECGNYLGQNLLDEPEKVATDPVLSFEAALWFWMNPHSTGAPSCHEVITGEWSPSEADIEAGRKPGFGMLTNIITNGGECTKDGKTRQQNRIDYYLRYCDML-----QVDPGDNLYCDNQETFEDN 307          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI2_HORVU (26 kDa endochitinase 2 OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 4.140e-44
Identity = 93/252 (36.90%), Postives = 129/252 (51.19%), Query Frame = 1
Query:  238 TISDYFQVYQFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            ++S      QF+     RN     A GF+ Y +F+ A   +   GFGTTG+   + +E+ AFLA    +T+ G+  A  G  AWG C+  E   S  YC  S ++  PC PG  YYGRG I +  NYNYG  G A+  DLL +P+ +  +AT+ F+ AIW WMT  +  +PS+H    G W P+  D  + R P FG   NI+ G   CG G    + + +  Y  Y D+LGVG         L C  Q+ F
Sbjct:   24 SVSSIVSRAQFDRMLLHRNDGACQAKGFYTYDAFVAAAAAFP--GFGTTGSADAQKREVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGASSDYCTPSAQW--PCAPGKRYYGRGPIQLSHNYNYGPAGRAIGVDLLANPDLVATDATVGFKTAIWFWMT-AQPPKPSSHAVIAGQWSPSGADRAAGRVPGFGVITNIINGGIECGHGQDSRVADRIGFYKRYCDILGVGY-----GNNLDCYSQRPF 265          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI2_SOLTU (Endochitinase 2 (Fragment) OS=Solanum tuberosum GN=CHTB2 PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 5.406e-44
Identity = 91/243 (37.45%), Postives = 130/243 (53.50%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVG-FWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F+   + RN       G F+ Y +FI+A   +   GFGTTG    + +EI AF A    +T+ G+  A  GP AWG C+  E      YC  S ++  PC PG +Y+GRG I I  NYNYG  G A+  DLLN+P+ +  ++ ++F++AIW WMTP +  +PS HD   G W+P+  D  + R P FG   NI+ G   CG G    + + +  Y  Y  +LGV      P + L C  Q++F
Sbjct:   75 FDQMLNHRNDNACQGKGNFYSYNAFISAAGSFP--GFGTTGDITARKREIAAFFAQTSHETTGGWASAPDGPYAWGYCFLREQGSPGDYCTPSNQW--PCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDSIISFKSAIWFWMTP-QSPKPSCHDVITGRWQPSGTDQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGFYRRYCGILGV-----SPGDNLDCGNQRSF 307          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI1_SOLTU (Endochitinase 1 (Fragment) OS=Solanum tuberosum GN=CHTB1 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 9.222e-44
Identity = 91/243 (37.45%), Postives = 130/243 (53.50%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVG-FWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F+   + RN       G F+ Y +FI+A   +   GFGTTG    + +EI AF A    +T+ G+  A  GP AWG C+  E      YC  S ++  PC PG +Y+GRG I I  NYNYG  G A+  DLLN+P+ +  ++ ++F++AIW WMTP +  +PS HD   G W+P+  D  + R P FG   NI+ G   CG G    + + +  Y  Y  +LGV      P + L C  Q++F
Sbjct:   77 FDQMLNHRNDNACQGKGNFYSYNAFISAAGSFP--GFGTTGDITARKREIAAFFAQTSHETTGGWPTAPDGPYAWGYCFLREQGSPGDYCTPSSQW--PCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDSVISFKSAIWFWMTP-QSPKPSCHDVITGRWQPSGVDQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGFYRRYCGILGV-----SPGDNLDCGNQRSF 309          
The following BLAST results are available for this feature:
BLAST of DC900363 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
CHI5_PHAVU4.890e-4538.02Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1[more]
CHI1_TOBAC4.890e-4536.78Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1... [more]
CHI2_TOBAC6.386e-4536.78Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1... [more]
CHI2_GOSHI8.341e-4537.86Endochitinase 2 (Fragment) OS=Gossypium hirsutum P... [more]
CHI9_ORYSJ1.858e-4436.63Chitinase 9 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIC_SOLLC4.140e-4437.86Basic 30 kDa endochitinase OS=Solanum lycopersicum... [more]
CHI8_POPTR4.140e-4434.44Endochitinase WIN8 OS=Populus trichocarpa GN=WIN8 ... [more]
CHI2_HORVU4.140e-4436.9026 kDa endochitinase 2 OS=Hordeum vulgare PE=1 SV=... [more]
CHI2_SOLTU5.406e-4437.45Endochitinase 2 (Fragment) OS=Solanum tuberosum GN... [more]
CHI1_SOLTU9.222e-4437.45Endochitinase 1 (Fragment) OS=Solanum tuberosum GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900363 VSS Citrus sinensis cDNA clone VS28931 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900363 ID=DC900363|Name=DC900363|organism=Citrus sinensis|type=EST|length=1374bp
CTCATCTTCCCCCAAGTGAATCTCGAAACAACAGGTAGATCTGGTGAGAA
CGAGAAAATGAAGATGAAGAATGGCAGTGTGGCAATGACACTGACAGTGG
CACTAGTACTGGCACTGGCAGTGAGTTTGGCAAATGGAGATGAATCAGAG
AAGGTGATAGTGAAGAAGTTGAAGGGGAAAAAAGTTTGCATAAAAGGGTG
GGAGTGCCCAACATGGTCGAAATTCTGCTGTAACGAGACGATATCAGACT
ATTTCCAGGTTTACCAGTTTGAGAATTTCTTCTCGAAAAGGAACACGCCG
GTGGCACATGCCGTGGGATTCTGGGATTATCAGTCTTTCATTACTGCCAC
CGTCAAATATCAGCCCCTCGGCTTCGGTACCACCGGTACTAAGCTTGATA
AGATGAAGGAGATTTGCGCTTTTCTTGCCCACGTGGGCTGCAAGACCTCT
TGTGGATATGGAGTGGCCACTGGAGGACCATTGGCCTGGGGACTTTGCTA
CAACCATGAAATGAGCCCCAGTCAGTCATATTGTGATGATTCCTACAAAT
ACACATATCCCTGCACCCCTGGAGCTGAGTACTATGGCCGAGGTGCTATA
CCTATATACTGGAACTATAACTATGGAGCCACTGGGGAAGCATTGAAGGC
AGATCTGTTGAATCATCCCGAATACATTGAGCAGAATGCTACCCTTGCCT
TTGAGGCTGCAATTTGGAAGTGGATGACCCCAGTCAAGAAATCCCAGCCT
TCAGCCCATGATGCCTTTGTTGGCAACTGGAAGCCCACCAAGAATGATAC
TTTGTCCAAACGGGGACCTAACTTTGGTACCACAATGAATATCCTCTATG
GTGAGAGCGTATGCGGTCAGGGTGATATTGATGCTATGAACAACATTGTC
TCTCATTACTTGTATTACCTTGATCTGTTGGGTGTTGGCCGAGAGCAGGC
AGGACCTAATGAAGAACTCTCTTGTGCTGAGCAGAAAGCCTTCAACCCAA
ACACCGCACCTTCAGCTGCATCTTCTTGAGGACGTTTATTGTAGCCAAGC
TATTATTGTGGGAGTGACTCTCTCTCTCTCTCTAGGTGGGTACCATTACA
ATAAGACTGGGGTTAATTAAACTATTTGTTGTAAGTTTTTTTTTTTTTTT
CCATCTTTTCATATATTGCGCAAGGTCAATTAGTGTGTGGATTGGTCTGC
CCCTCTTCATTGCCGTTGTAGATTTGAGATTCATTTGGTTTGTAAAATCT
TCGTTATATCTGGTTACATATGTAATGATGAACCGCATGAACCACTCGTG
TGTTTCAATAGCAGAATTGTAAAGTATATGCTTATATTTTATTTATTCCG
GGATATCGACTCCTAGTTTCGTTT
back to top