DC900363

Overview
NameDC900363
Unique NameDC900363
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1374
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900363_ssr1068 microsatellite DC900363_ssr1068:1068..1083. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7102 contig Csv1_Contig7102:114..1481. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI10_ORYSJ (Chitinase 10 OS=Oryza sativa subsp. japonica GN=Cht10 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 9.222e-44
Identity = 92/242 (38.02%), Postives = 132/242 (54.55%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            + + F  ++     A GF+ Y SF+ A  ++    F  TG    + +E+ AFLA +  +T+ G+  A  GP AWGLCY  E++P  SYCD + K  +PC PG  Y+GRG I I WN+NYG  G+AL  D L +PE +   + +AF+ A+W WMTP + ++PS H   VG ++P   D  + R   FG   NI+ G   C +     +NN +  Y  Y  +LGV     GPN  L C  Q+ F
Sbjct:   58 YASLFLHKDDAACPARGFYTYASFVRAATRFPR--FAATGCADARKREVAAFLAQISHETTGGWATAPDGPYAWGLCYKEEINPQSSYCDATDKQ-WPCYPGKSYHGRGPIQISWNFNYGPAGQALGFDGLRNPEIVANCSDIAFQTALWFWMTP-RDTKPSCHQVMVGEYRPGPADVAANRTAGFGLVTNIVNGGLECNRAGDARVNNRIGFYRRYCQVLGV---DVGPN--LDCEHQQPF 290          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI2_PEA (Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=2)

HSP 1 Score: 177.563 bits (449), Expect = 1.573e-43
Identity = 90/252 (35.71%), Postives = 129/252 (51.19%), Query Frame = 1
Query:  238 TISDYFQVYQFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            T+S       F N    RN        F+ Y +F++A   +    F   G    K +EI AFL     +T+ G+  A  GP AWG C+  E +PS +YC  S ++  PC  G +YYGRG I I WNYNYG  G A+  DLLN+P+ +  +  ++F+ A+W WMTP +  +PS HD   G W P+  D  + R P +GT  NI+ G   CG+G    + + +  Y  Y D+ G+G       + L C  Q+ F
Sbjct:   67 TLSSLISGDTFNNMLKHRNDNACQGKPFYTYDAFLSAAKAFP--NFANKGDTATKKREIAAFLGQTSHETTGGWPTAPDGPYAWGYCFLREQNPS-TYCQASSEF--PCASGKQYYGRGPIQISWNYNYGQCGRAIGVDLLNNPDLVATDPVISFKTALWFWMTP-QSPKPSCHDVITGGWTPSSADRAAGRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFYKRYCDIFGIGY-----GDNLDCYSQRPF 307          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI3_SOLTU (Endochitinase 3 (Fragment) OS=Solanum tuberosum GN=CHTB3 PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 2.054e-43
Identity = 91/243 (37.45%), Postives = 130/243 (53.50%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVG-FWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F+   + RN         F+ Y +FI+A   +   GFGTTG    + +EI AFLA    +T+ G+  A  GP AWG C+  E      YC  S ++  PC PG +Y+GRG I I  NYNYG  G A+  DLLN+P+ +  ++ ++F++AIW WMTP +  +PS HD   G W+P+  D  + R P FG   NI+ G   CG G    + + +  Y  Y  +LGV      P + L C  Q++F
Sbjct:   77 FDQMLNHRNDNACQGKNNFYSYNAFISAAGSFP--GFGTTGDITARKREIAAFLAQTSHETTGGWPSAPDGPYAWGYCFLREQGSPGDYCTPSSQW--PCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDSVISFKSAIWFWMTP-QSPKPSCHDVITGRWQPSGADQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGFYRRYCGILGV-----SPGDNLDCGNQRSF 309          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIC_SECCE (Basic endochitinase C OS=Secale cereale GN=rscc PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.020e-42
Identity = 88/252 (34.92%), Postives = 129/252 (51.19%), Query Frame = 1
Query:  238 TISDYFQVYQFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            ++S      QF+     RN     A GF+ Y +F+ A   +   GFG TG+   + +++ AFLA    +T+ G+  A  G  AWG C+  E   +  YC  S ++  PC PG  YYGRG I +  NYNYG  G A+  DLL +P+ +  + T++F+ A+W WMT  +  +PS+H    G W P+  D  + R P FG   NI+ G   CG G    + + +  Y  Y D+LGVG       + L C  Q+ F
Sbjct:   24 SVSSIISHAQFDRMLLHRNDGACQAKGFYTYDAFVAAANAFP--GFGATGSTDARKRDVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGAAADYCTPSAQW--PCAPGKRYYGRGPIQLSHNYNYGPAGRAIGVDLLRNPDLVATDPTVSFKTALWFWMT-AQAPKPSSHAVITGKWSPSGADRAAGRAPGFGVITNIINGGLECGHGQDSRVADRIGFYKRYCDILGVGY-----GDNLDCYNQRPF 265          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI1_HORVU (26 kDa endochitinase 1 OS=Hordeum vulgare PE=2 SV=4)

HSP 1 Score: 174.481 bits (441), Expect = 1.332e-42
Identity = 88/242 (36.36%), Postives = 126/242 (52.07%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F+     RN     A GF+ Y +F+ A   ++  GFGTTG    + +E+ AFLA    +T+ G+  A  G  AWG C+  E   + +YC  S ++  PC PG  YYGRG I +  NYNYG  G A+  DLL +P+ +  + T++F+ A+W WMT  +  +PS+H    G W P+  D  + R P FG   NI+ G   CG G    + + +  Y  Y D+LGVG         L C  Q+ F
Sbjct:   86 FDRMLLHRNDGACQAKGFYTYDAFVAAASAFR--GFGTTGGTDTRKREVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGATSNYCTPSAQW--PCAPGKSYYGRGPIQLSHNYNYGPAGRAIGVDLLRNPDLVATDPTVSFKTAMWFWMT-AQAPKPSSHAVITGQWSPSGTDRAAGRVPGFGVITNIVNGGIECGHGQDSRVADRIGFYKRYCDILGVGY-----GNNLDCYSQRPF 317          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIT_SOLTU (Endochitinase OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.739e-42
Identity = 88/242 (36.36%), Postives = 126/242 (52.07%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F+     RN        F+ Y +FI A   +   GFGT+G    + +EI AF A    +T+ G+  A  GP AWG C+  E      YC  S ++  PC PG +Y+GRG I I  NYNYG  G A+  DLLN+P+ +  +  ++F+ A+W WMTP +  +PS HD  +G W P+  D  + R P FG   NI+ G   CG+G  + + + +  Y  Y  +LGV      P + L C  Q+ F
Sbjct:   88 FDQMLKHRNENSCQGKNFYSYNAFINAARSFP--GFGTSGDINARKREIAAFFAQTSHETTGGWASAPDGPYAWGYCFLRERGNPGDYCPPSSQW--PCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDPVISFKTALWFWMTP-QSPKPSCHDVIIGRWNPSSADRAANRLPGFGVITNIINGGLECGRGTDNRVQDRIGFYRRYCSILGV-----TPGDNLDCVNQRWF 319          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIB_VITVI (Basic endochitinase OS=Vitis vinifera GN=CHIT1B PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 2.271e-42
Identity = 90/242 (37.19%), Postives = 127/242 (52.48%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F +    RN       GF+ Y +FI A   +   GFGTTG    + +EI AFLA    +T+ G+  A  GP AWG CY  E     +YC  S ++  PC  G +YYGRG I I +NYNYG  G+A+  DL+N+P+ +  +A ++F+ A W WMTP +  +PS H+   G W P+  D  + R P FG   NI+ G   CG+G +  + + +  Y  Y D+L V          L C  Q+ F
Sbjct:   74 FNDMLKHRNEGSCPGKGFYTYDAFIAAAKAFP--GFGTTGDTTTRKREIAAFLAQTSHETTGGWASAPDGPYAWGYCYLREQGSPGAYCVPSAQW--PCAAGRKYYGRGPIQISYNYNYGQAGKAIGVDLVNNPDLVATDAVISFKTAFWFWMTP-QSPKPSCHNVITGGWTPSGADRSAGRLPGFGVITNIINGGVECGKGVVPQVQDRIGFYKRYCDILRVSY-----GNNLDCNNQRPF 305          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI3_ORYSJ (Chitinase 3 OS=Oryza sativa subsp. japonica GN=Cht3 PE=2 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 8.631e-42
Identity = 89/246 (36.18%), Postives = 132/246 (53.66%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQ-SYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFNPN 1002
            F+     RN     A GF+ Y +F+ A   Y    F TTG      +E+ AFLA    +T+ G+  A  GP +WG C+  E + +  +YC+   K  +PC  G +YYGRG I I +NYNYG  G+A+ +DLLN+P+ +  +AT++F+ A W WMTP +  +PS H    G W P+ +D  + R P +G   NI+ G   CG G  D + + +  Y  Y D+LGV        + L C  Q+ + P+
Sbjct:   85 FDQMLLHRNDQACAAKGFYTYDAFVAAANAYPD--FATTGDADTCKREVAAFLAQTSHETTGGWPTAPDGPYSWGYCFKEENNGNAPTYCEP--KPEWPCAAGKKYYGRGPIQITYNYNYGPAGQAIGSDLLNNPDLVASDATVSFKTAFWFWMTP-QSPKPSCHAVITGQWTPSADDQAAGRVPGYGEITNIINGGVECGHGADDKVADRIGFYKRYCDMLGVSY-----GDNLDCYNQRPYPPS 320          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIA_SECCE (Basic endochitinase A OS=Secale cereale GN=rsca PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.127e-41
Identity = 87/242 (35.95%), Postives = 125/242 (51.65%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F+     RN     A GF+ Y +F+ A   +   GFGTTG+   + +E+ AFLA    +T+ G+  A  G  AWG C+  E   + +YC  S ++  PC PG  YYGRG I +  NYNYG  G A+  DLL +P+ +  + T++F+ A+W WMT  +  +PS+H    G W P+  D  + R P FG   NI+ G   CG G    + + +  Y  Y D+L VG         L C  Q+ F
Sbjct:   89 FDRMLLHRNDGACQAKGFYTYDAFVAAAGAFP--GFGTTGSTDTRKREVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGATSNYCTPSAQW--PCAPGKSYYGRGPIQLSHNYNYGPAGRAIGVDLLRNPDLVATDPTVSFKTAMWFWMT-AQAPKPSSHAVITGQWSPSGTDRAAGRVPGFGVITNIVNGGIECGHGQDSRVADRIGFYKRYCDILRVGY-----GNNLDCYNQRPF 320          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI7_ORYSJ (Chitinase 7 OS=Oryza sativa subsp. japonica GN=Cht7 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.284e-41
Identity = 96/253 (37.94%), Postives = 133/253 (52.57%), Query Frame = 1
Query:  265 QFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFNPNTAPSAAS 1023
            QFE     R+     A GF+ Y++F+ A   +    F  TG    + +E+ AFLA     TS       GGP +WG CY      +  +C  + ++  PC PG  Y+ RG + I +NYNYGA GEA+ ADLL +PE +  + T+AF+ A+W WMT    SQPS H    G W PT  D+ + R P +G T NIL G   C  G+  A  + V+ Y  Y D+LGVG    GPN  L C  Q  F+ +   ++A+
Sbjct:  105 QFERMLPHRDDAACPARGFYAYRAFVAAAGAFP--AFAATGDADTRKREVAAFLAQTSHATS-------GGPYSWGYCYKEVKGATSDFCVPNARW--PCAPGKAYHARGPMQIAYNYNYGAAGEAIGADLLGNPELVATDPTVAFKTALWLWMTARSPSQPSPHAVVTGQWTPTPADSAAGRAPGYGLTTNILTGGLQCAGGNGGA--DRVAFYKRYCDVLGVG---YGPN--LDCFGQAPFDGDIMSASAA 339          
The following BLAST results are available for this feature:
BLAST of DC900363 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
CHI10_ORYSJ9.222e-4438.02Chitinase 10 OS=Oryza sativa subsp. japonica GN=Ch... [more]
CHI2_PEA1.573e-4335.71Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=... [more]
CHI3_SOLTU2.054e-4337.45Endochitinase 3 (Fragment) OS=Solanum tuberosum GN... [more]
CHIC_SECCE1.020e-4234.92Basic endochitinase C OS=Secale cereale GN=rscc PE... [more]
CHI1_HORVU1.332e-4236.3626 kDa endochitinase 1 OS=Hordeum vulgare PE=2 SV=... [more]
CHIT_SOLTU1.739e-4236.36Endochitinase OS=Solanum tuberosum PE=2 SV=1[more]
CHIB_VITVI2.271e-4237.19Basic endochitinase OS=Vitis vinifera GN=CHIT1B PE... [more]
CHI3_ORYSJ8.631e-4236.18Chitinase 3 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIA_SECCE1.127e-4135.95Basic endochitinase A OS=Secale cereale GN=rsca PE... [more]
CHI7_ORYSJ4.284e-4137.94Chitinase 7 OS=Oryza sativa subsp. japonica GN=Cht... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900363 VSS Citrus sinensis cDNA clone VS28931 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900363 ID=DC900363|Name=DC900363|organism=Citrus sinensis|type=EST|length=1374bp
CTCATCTTCCCCCAAGTGAATCTCGAAACAACAGGTAGATCTGGTGAGAA
CGAGAAAATGAAGATGAAGAATGGCAGTGTGGCAATGACACTGACAGTGG
CACTAGTACTGGCACTGGCAGTGAGTTTGGCAAATGGAGATGAATCAGAG
AAGGTGATAGTGAAGAAGTTGAAGGGGAAAAAAGTTTGCATAAAAGGGTG
GGAGTGCCCAACATGGTCGAAATTCTGCTGTAACGAGACGATATCAGACT
ATTTCCAGGTTTACCAGTTTGAGAATTTCTTCTCGAAAAGGAACACGCCG
GTGGCACATGCCGTGGGATTCTGGGATTATCAGTCTTTCATTACTGCCAC
CGTCAAATATCAGCCCCTCGGCTTCGGTACCACCGGTACTAAGCTTGATA
AGATGAAGGAGATTTGCGCTTTTCTTGCCCACGTGGGCTGCAAGACCTCT
TGTGGATATGGAGTGGCCACTGGAGGACCATTGGCCTGGGGACTTTGCTA
CAACCATGAAATGAGCCCCAGTCAGTCATATTGTGATGATTCCTACAAAT
ACACATATCCCTGCACCCCTGGAGCTGAGTACTATGGCCGAGGTGCTATA
CCTATATACTGGAACTATAACTATGGAGCCACTGGGGAAGCATTGAAGGC
AGATCTGTTGAATCATCCCGAATACATTGAGCAGAATGCTACCCTTGCCT
TTGAGGCTGCAATTTGGAAGTGGATGACCCCAGTCAAGAAATCCCAGCCT
TCAGCCCATGATGCCTTTGTTGGCAACTGGAAGCCCACCAAGAATGATAC
TTTGTCCAAACGGGGACCTAACTTTGGTACCACAATGAATATCCTCTATG
GTGAGAGCGTATGCGGTCAGGGTGATATTGATGCTATGAACAACATTGTC
TCTCATTACTTGTATTACCTTGATCTGTTGGGTGTTGGCCGAGAGCAGGC
AGGACCTAATGAAGAACTCTCTTGTGCTGAGCAGAAAGCCTTCAACCCAA
ACACCGCACCTTCAGCTGCATCTTCTTGAGGACGTTTATTGTAGCCAAGC
TATTATTGTGGGAGTGACTCTCTCTCTCTCTCTAGGTGGGTACCATTACA
ATAAGACTGGGGTTAATTAAACTATTTGTTGTAAGTTTTTTTTTTTTTTT
CCATCTTTTCATATATTGCGCAAGGTCAATTAGTGTGTGGATTGGTCTGC
CCCTCTTCATTGCCGTTGTAGATTTGAGATTCATTTGGTTTGTAAAATCT
TCGTTATATCTGGTTACATATGTAATGATGAACCGCATGAACCACTCGTG
TGTTTCAATAGCAGAATTGTAAAGTATATGCTTATATTTTATTTATTCCG
GGATATCGACTCCTAGTTTCGTTT
back to top