DC900363

Overview
NameDC900363
Unique NameDC900363
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1374
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900363_ssr1068 microsatellite DC900363_ssr1068:1068..1083. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7102 contig Csv1_Contig7102:114..1481. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI7_ORYSI (Chitinase 7 OS=Oryza sativa subsp. indica GN=Cht7 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 5.595e-41
Identity = 96/253 (37.94%), Postives = 132/253 (52.17%), Query Frame = 1
Query:  265 QFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFNPNTAPSAAS 1023
            QFE     R+     A GF+ Y++F+ A   +    F  TG    + +E+ AFLA     TS       GGP +WG CY      +  +C  + ++  PC PG  Y+ RG + I +NYNYGA GEA+ ADLL +PE +  + T+AF+ A+W WMT    SQPS H    G W PT  D+ + R P +G T NIL G   C  G+  A  + V+ Y  Y D+LGVG    GPN  L C  Q  F+     ++A+
Sbjct:  105 QFERMLPHRDDAACPARGFYAYRAFVAAAGAFP--AFAATGDADTRKREVAAFLAQTSHATS-------GGPYSWGYCYKEVKGATSDFCVPNARW--PCAPGKAYHARGPMQIAYNYNYGAAGEAIGADLLGNPELVATDPTVAFKTALWLWMTARSPSQPSPHAVVTGQWTPTPADSAAGRAPGYGLTTNILTGGLQCAGGNGGA--DRVAFYKRYCDVLGVG---YGPN--LDCFGQAPFDGGIMSASAA 339          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI6_POPTR (Acidic endochitinase WIN6 OS=Populus trichocarpa GN=WIN6 PE=2 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 5.595e-41
Identity = 98/252 (38.89%), Postives = 132/252 (52.38%), Query Frame = 1
Query:  241 ISDYFQVYQFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMN-NIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            +SD     +F+     RN     A GF+ Y +FI+A  ++    FG TG  L + +EI AFL     +T+ G+  A  GP AWG CY  E++  Q YCD S  Y   C  G +Y GRG I + WNYNYG  G+ LK  LL  PE +E +  ++F+ AIW WM P +  +PS H    GNW P+  D  + R P +G   NI+ G   CGQG  +A N + +  Y  Y D LG      G N  L C +Q+ F
Sbjct:   89 LSDIIPKSKFDALLKFRNDARCPAAGFYTYNAFISAAKEFPD--FGNTGDDLMRKREIAAFLGQTSHETTGGWPDAPCGPYAWGYCYLKEIN-CQPYCDPSSNYQ--CVAGKQYCGRGPIQLSWNYNYGLCGDDLKLPLLQEPELVETDPVISFKTAIWFWMKP-QSPKPSCHAVITGNWTPSAADLEAGRVPGYGVITNIINGGIECGQGGPNAANEDRIGFYKKYCDSLGT---TYGSN--LDCYQQRPF 329          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI1_ORYSJ (Chitinase 1 OS=Oryza sativa subsp. japonica GN=Cht1 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 2.126e-40
Identity = 88/245 (35.92%), Postives = 129/245 (52.65%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPS--QSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFN 996
            F+     RN     A  F+ Y +F+ A   +    F TTG    + +E+ AFLA    +T+ G+  A  GP +WG C+  E + +    YC  S ++  PC  G +YYGRG I I +NYNYG  G+A+ ++LL++P+ +  +AT++F+ A W WMTP +  +PS H    G W P  ND  + R P +G   NI+ G   CG G    + + +  Y  Y D+LGV     G N  L C  Q+ FN
Sbjct:   88 FDQMLLHRNDAACPAKNFYTYDAFVAAANAFP--SFATTGDAATRKREVAAFLAQTSHETTGGWATAPDGPYSWGYCFKEENNGNVGSDYCVQSSQW--PCAAGKKYYGRGPIQISYNYNYGPAGQAIGSNLLSNPDLVASDATVSFKTAFWFWMTP-QSPKPSCHAVMTGQWTPNGNDQAAGRVPGYGVVTNIINGGVECGHGADSRVADRIGFYKRYCDMLGV---SYGAN--LDCYNQRPFN 322          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI12_ORYSJ (Chitinase 12 OS=Oryza sativa subsp. japonica GN=Cht12 PE=2 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 1.055e-39
Identity = 87/245 (35.51%), Postives = 126/245 (51.43%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMK-EICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEM--SPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F+     RN     A  F+ Y +F+ A   +   GF   G   D  K E+ AFLA    +T+ G+  A  GP AWG C+  E   +    YC  S ++  PC  G +YYGRG I + +N+NYG  G+A+ ADLL  P+ +  +AT++F+ A W WMTP +  +PS H    G W P+ +D  + R P +G   NI+ G   CG G+ D + + +  Y  Y D+LGV  +       L C  Q+ F
Sbjct:   90 FDQMLLHRNDAACPASNFYTYDAFVAAASAFP--GFAAAGGDADTNKREVAAFLAQTSHETTGGWATAPDGPYAWGYCFKEENGGAAGPDYCQQSAQW--PCAAGKKYYGRGPIQLSYNFNYGPAGQAIGADLLGDPDLVASDATVSFDTAFWFWMTP-QSPKPSCHAVATGQWTPSADDQAAGRVPGYGVITNIINGGLECGHGEDDRVADRIGFYKRYCDILGVSYD-----ANLDCYSQRPF 324          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI4_SOLTU (Endochitinase 4 (Fragment) OS=Solanum tuberosum GN=CHTB4 PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 3.070e-39
Identity = 82/218 (37.61%), Postives = 116/218 (53.21%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVG-FWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYY 918
            F+     RN         F+ Y +FI A   +   GFGTTG    + +EI AF A    +T+ G+  A  GP AWG C+  E      YC  S ++  PC PG +Y+GRG I I  NYNYG  G A+  DLLN+P+ +  +  ++F++AIW WMTP +  +PS HD  +G W+P+  D  + R P FG   NI+ G   CG+G    + + +  Y  Y
Sbjct:   87 FDQMLKHRNDNACQGKNNFYSYNAFINAARSFG--GFGTTGDTTARKREIAAFFAQTSHETTGGWPTAPDGPYAWGYCFLREQGSPGDYCTPSGQW--PCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSAIWFWMTP-QSPKPSCHDVIIGRWQPSAADRAANRLPGFGVITNIINGGLECGRGSDSRVQDRIGFYRRY 299          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI11_ORYSJ (Chitinase 11 OS=Oryza sativa subsp. japonica GN=Cht11 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.381e-31
Identity = 80/243 (32.92%), Postives = 116/243 (47.74%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQG-DIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            FE+  S R         F+ Y +FI A   +    FGTTG    + +E+ AF      +T+ G+  A  GP AWG C  +E++PS                   YYGRG I +   YNY   G+AL  DL+N+P+ +  +  +AF  AIW WMT  +  +PS HD     W P+ +D  S R P +G   NI+ G   CG+G   D   + V +Y  Y D+  VG       + ++C +QK +
Sbjct:   36 FESMLSHRGDQGCQGA-FYTYDAFIKAAGDFPR--FGTTGNDETRRRELAAFFGQTSHETTGGWATAPDGPFAWGYCRVNEITPSDP----------------PYYGRGPIQLTHKYNYQLAGDALGLDLVNNPDLVSSDPVVAFRTAIWFWMT-AQSPKPSCHDVITNQWTPSGDDRSSGRLPGYGMATNIINGGEECGKGYSTDNAKDRVGYYKRYCDMFRVGY-----GDNIACRDQKPY 253          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIT_PETHY (Acidic endochitinase OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.356e-31
Identity = 79/242 (32.64%), Postives = 119/242 (49.17%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F+     RN     AV F+ Y +FI A   +   GFGTTG    + KEI AF      +T+ G  ++  GP A G C+  E +                  G  YYGRG I +    NY   G+A++ DL+N+P+ +  +AT++F+ AIW WMTP + ++PS HD   G W P+  DT + R P +G   NI+ G   CG+G    + + + +Y   + ++ V      P + L C  Q+ F
Sbjct:   35 FDQMLKNRNDARCFAVRFYTYDAFIAAANSFP--GFGTTGDDTARKKEIAAFFGQTSHETTGGT-LSPDGPYAGGYCFLREGNQM----------------GNGYYGRGPIQLTGQSNYDLAGKAIEQDLVNNPDLVATDATVSFKTAIWFWMTP-QGNKPSCHDVITGRWTPSAADTSANRVPGYGVITNIINGGIECGKGQNARVEDRIGYYRRNVSIMNV-----APGDNLDCYNQRNF 251          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIB_SOLLC (Acidic 27 kDa endochitinase OS=Solanum lycopersicum GN=CHI17 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 5.249e-31
Identity = 78/242 (32.23%), Postives = 116/242 (47.93%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F      RN     A GF+ Y +FI A   +   GFGTTG    + KEI AF      +T+ G  ++  GP A G C+  E +                  G+ +YGRG I +    NY   G+A+  DL+N+P+ +  +AT++F+ AIW WMT  + ++PS HD   G W P+  D  + R P +G   NI+ G   CG+G    + + +  Y  Y  +L V      P + L C +Q+ F
Sbjct:   28 FNEMLKNRNDDRCPAKGFYTYDAFIAAANSFP--GFGTTGDDTARKKEIAAFFGQTSHETTGG-SLSADGPFAGGYCFVREGNQM----------------GSGFYGRGPIQLTGQSNYDLAGQAIGQDLVNNPDLVATDATVSFKTAIWFWMT-AQGNKPSCHDVITGQWTPSAADASANRQPGYGVITNIINGGIECGKGQNPQVEDRIGFYRRYCTILNV-----APGDNLDCYDQRNF 244          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIQ_TOBAC (Acidic endochitinase Q OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.605e-30
Identity = 79/242 (32.64%), Postives = 114/242 (47.11%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F      RN     A GF+ Y +FI A   +   GFGTTG    + KEI AF      +T+ G    +  P   G C+  +   S                   YYGRG I +    NY   G A+  +L+N+P+ +  +AT++F+ AIW WMTP + ++PS+HD  +G W P+  D  + R P +G   NI+ G   CG G  DA+ + + +Y  Y  +L V      P E L C  Q+ F
Sbjct:   36 FNEMLKNRNDGRCPANGFYTYDAFIAAANSFP--GFGTTGDDTARRKEIAAFFGQTSHETTGGS--LSAEPFTGGYCFVRQNDQSD-----------------RYYGRGPIQLTNRNNYEKAGTAIGQELVNNPDLVATDATISFKTAIWFWMTP-QDNKPSSHDVIIGRWTPSAADQAANRVPGYGVITNIINGGIECGIGRNDAVEDRIGYYRRYCGMLNV-----APGENLDCYNQRNF 250          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIP_TOBAC (Acidic endochitinase P OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 1.293e-29
Identity = 77/242 (31.82%), Postives = 114/242 (47.11%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F      RN     A GF+ Y +FI A   +   GFGT+G    + KEI AF      +T+ G    +  P   G C+  +   S                   YYGRG I +    NY   G A++ DL+N+P+ +  +AT++F+ AIW WMTP + ++PS+HD  +G+W P+  D  + R P  G   NI+ G   CG G   A+ + + +Y  Y  +L V      P + L C  Q+ F
Sbjct:   36 FNEMLKNRNDGRCPANGFYTYDAFIAAANSFP--GFGTSGDDTARRKEIAAFFGQTSHETTGGS--LSAEPFTGGYCFVRQNDQSD-----------------RYYGRGPIQLTNQNNYEKAGNAIRQDLVNNPDLVATDATISFKTAIWFWMTP-QDNKPSSHDVIIGSWTPSAADQSANRAPGCGVITNIINGGIECGVGPNAAVEDRIGYYRRYCGMLNV-----APGDNLDCYNQRNF 250          
The following BLAST results are available for this feature:
BLAST of DC900363 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
CHI7_ORYSI5.595e-4137.94Chitinase 7 OS=Oryza sativa subsp. indica GN=Cht7 ... [more]
CHI6_POPTR5.595e-4138.89Acidic endochitinase WIN6 OS=Populus trichocarpa G... [more]
CHI1_ORYSJ2.126e-4035.92Chitinase 1 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI12_ORYSJ1.055e-3935.51Chitinase 12 OS=Oryza sativa subsp. japonica GN=Ch... [more]
CHI4_SOLTU3.070e-3937.61Endochitinase 4 (Fragment) OS=Solanum tuberosum GN... [more]
CHI11_ORYSJ1.381e-3132.92Chitinase 11 OS=Oryza sativa subsp. japonica GN=Ch... [more]
CHIT_PETHY2.356e-3132.64Acidic endochitinase OS=Petunia hybrida PE=2 SV=1[more]
CHIB_SOLLC5.249e-3132.23Acidic 27 kDa endochitinase OS=Solanum lycopersicu... [more]
CHIQ_TOBAC2.605e-3032.64Acidic endochitinase Q OS=Nicotiana tabacum PE=1 S... [more]
CHIP_TOBAC1.293e-2931.82Acidic endochitinase P OS=Nicotiana tabacum PE=1 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900363 VSS Citrus sinensis cDNA clone VS28931 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900363 ID=DC900363|Name=DC900363|organism=Citrus sinensis|type=EST|length=1374bp
CTCATCTTCCCCCAAGTGAATCTCGAAACAACAGGTAGATCTGGTGAGAA
CGAGAAAATGAAGATGAAGAATGGCAGTGTGGCAATGACACTGACAGTGG
CACTAGTACTGGCACTGGCAGTGAGTTTGGCAAATGGAGATGAATCAGAG
AAGGTGATAGTGAAGAAGTTGAAGGGGAAAAAAGTTTGCATAAAAGGGTG
GGAGTGCCCAACATGGTCGAAATTCTGCTGTAACGAGACGATATCAGACT
ATTTCCAGGTTTACCAGTTTGAGAATTTCTTCTCGAAAAGGAACACGCCG
GTGGCACATGCCGTGGGATTCTGGGATTATCAGTCTTTCATTACTGCCAC
CGTCAAATATCAGCCCCTCGGCTTCGGTACCACCGGTACTAAGCTTGATA
AGATGAAGGAGATTTGCGCTTTTCTTGCCCACGTGGGCTGCAAGACCTCT
TGTGGATATGGAGTGGCCACTGGAGGACCATTGGCCTGGGGACTTTGCTA
CAACCATGAAATGAGCCCCAGTCAGTCATATTGTGATGATTCCTACAAAT
ACACATATCCCTGCACCCCTGGAGCTGAGTACTATGGCCGAGGTGCTATA
CCTATATACTGGAACTATAACTATGGAGCCACTGGGGAAGCATTGAAGGC
AGATCTGTTGAATCATCCCGAATACATTGAGCAGAATGCTACCCTTGCCT
TTGAGGCTGCAATTTGGAAGTGGATGACCCCAGTCAAGAAATCCCAGCCT
TCAGCCCATGATGCCTTTGTTGGCAACTGGAAGCCCACCAAGAATGATAC
TTTGTCCAAACGGGGACCTAACTTTGGTACCACAATGAATATCCTCTATG
GTGAGAGCGTATGCGGTCAGGGTGATATTGATGCTATGAACAACATTGTC
TCTCATTACTTGTATTACCTTGATCTGTTGGGTGTTGGCCGAGAGCAGGC
AGGACCTAATGAAGAACTCTCTTGTGCTGAGCAGAAAGCCTTCAACCCAA
ACACCGCACCTTCAGCTGCATCTTCTTGAGGACGTTTATTGTAGCCAAGC
TATTATTGTGGGAGTGACTCTCTCTCTCTCTCTAGGTGGGTACCATTACA
ATAAGACTGGGGTTAATTAAACTATTTGTTGTAAGTTTTTTTTTTTTTTT
CCATCTTTTCATATATTGCGCAAGGTCAATTAGTGTGTGGATTGGTCTGC
CCCTCTTCATTGCCGTTGTAGATTTGAGATTCATTTGGTTTGTAAAATCT
TCGTTATATCTGGTTACATATGTAATGATGAACCGCATGAACCACTCGTG
TGTTTCAATAGCAGAATTGTAAAGTATATGCTTATATTTTATTTATTCCG
GGATATCGACTCCTAGTTTCGTTT
back to top