DC900363

Overview
NameDC900363
Unique NameDC900363
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1374
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900363_ssr1068 microsatellite DC900363_ssr1068:1068..1083. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7102 contig Csv1_Contig7102:114..1481. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI8_ORYSJ (Chitinase 8 OS=Oryza sativa subsp. japonica GN=Cht8 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 1.429e-28
Identity = 77/243 (31.69%), Postives = 116/243 (47.74%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMK-EICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F +    R+     A GF+ Y +FI A   +    FGT+G   + ++ E+ AF      +T+ G    +     WG C+  E++ + S                 YYGRG I +    NY A G AL  DL+ +P+ +  +A ++F+ AIW WMT  + ++PS HD  +G W P+  DT + R P +G   NI+ G   CG G  DA  + + +Y  Y D+LG     AG    L C  Q+ F
Sbjct:   41 FNSMLPNRDNSQCPARGFYTYDAFIAAANSFP--AFGTSGGSAELIRRELAAFFGQTSHETTGGTR-GSSDQFQWGYCFKEEINKATS---------------PPYYGRGPIQLTGQSNYQAAGNALGLDLVGNPDLVSTDAVVSFKTAIWFWMT-AQGNKPSCHDVILGRWTPSAADTAAGRVPGYGVITNIINGGIECGVGQNDANVDRIGYYKRYCDMLG-----AGYGSNLDCYNQRNF 259          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIT_AVESA (Endochitinase (Fragments) OS=Avena sativa PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 2.064e-27
Identity = 67/203 (33.00%), Postives = 102/203 (50.25%), Query Frame = 1
Query:  316 GFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLD 924
            GF+ Y +FI A   +    F TTG+   + +E+ AFLA    +T+ G+  A  GP                         Y     ++Y+GRG I I +NYNYGA G+A+  DLL +P+ +  + T+ F+ A+W WMTP +  +PS+HD   G W P+  D  + R P +G   NI+ G   CG+G    + + + +Y   LD
Sbjct:   18 GFYTYDAFIAAAKSFP--AFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGP-------------------------YELGSTSDYFGRGPIQISYNYNYGAAGKAIGVDLLRNPDLVTSDNTVEFKTALWFWMTP-QSPKPSSHDVITGRWSPSSTDKAAGRVPGYGVLTNIIDGGVECGKGQESHVADRIGYYKDNLD 192          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIA_SOLLC (Acidic 26 kDa endochitinase OS=Solanum lycopersicum GN=CHI3 PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 6.005e-27
Identity = 75/244 (30.74%), Postives = 110/244 (45.08%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKA--DLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            FE   S RN     A GF+ Y +FI A   +   GFGT G    + KEI AF      +T+ G    + G    G C+  ++  S                   YYGRG I +    NY   G+ +    +L+N+P+ +  +  ++F+ AIW WMT  + ++PS H+  +G W P+  DT + R P +G   NI+ G+  CG G   A  + +  Y  Y  +L V        E L C  QK F
Sbjct:   36 FEQMLSFRNNDACPAKGFYTYDAFIAAANSFP--GFGTAGDDTARKKEIAAFFGQTSHETNGG----SAGTFTGGYCFVKQIEQSD-----------------RYYGRGPIQLTHQSNYERAGQGIGVGQELVNNPDLVATDPIISFKTAIWFWMTE-QDNKPSCHNVIIGQWTPSPKDTAANRVPGYGVITNIINGQFECGMGPNTAAESRIGFYRRYCGMLNV-----PTGENLDCNNQKNF 250          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIA_SOLCI (Acidic endochitinase pcht28 OS=Solanum chilense PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 7.843e-27
Identity = 76/244 (31.15%), Postives = 108/244 (44.26%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKA--DLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            FE   S RN     A GF+ Y +FI A   +   GFGTTG    + KEI AF      +T  G    + G    G C+  ++  S                   YYGRG I +    NY   G+ +    DL+N+P+ +  +  ++F  AIW WMT  + ++PS H+  +G W P+  DT + R P +G   NI+ G   C  G   A+ + +  Y  Y  +L V        E L C  QK F
Sbjct:   36 FEQMLSFRNNDACPAKGFYTYDAFIAAANSFP--GFGTTGDDTARKKEIAAFFGQTSHETKGG----SAGTFTGGYCFVRQIDQSD-----------------RYYGRGPIQLTHQSNYERAGQGIGVGQDLVNNPDLVATDPIISFRTAIWFWMT-AQDNKPSCHNVIIGQWTPSPADTAANRVPGYGVITNIINGGLECNMGPNTAVESRIGFYRRYCGMLNV-----PTGENLDCNNQKNF 250          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIB_POPTR (Acidic endochitinase WIN6.2B OS=Populus trichocarpa PE=2 SV=2)

HSP 1 Score: 120.553 bits (301), Expect = 2.282e-26
Identity = 79/252 (31.35%), Postives = 111/252 (44.05%), Query Frame = 1
Query:  241 ISDYFQVYQFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMN-NIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            +SD      F++    RN P   AVGF+ Y +FI+A  ++    FG TG  L + +EI AFL     +T+  +  A G    WG C+                                     NYNYG  G+ L   LL  PE +E +  +AF+ A+W WMTP +  +PS H     +W P+  D+ + R P +G   NI+ G   CGQG  +  N N +  Y  Y D LG      G N  L C +Q+ F
Sbjct:   85 LSDIIPESMFDDMLKYRNDPQCPAVGFYTYNAFISAAKEFPD--FGNTGDDLMRKREIAAFLGQTSHETNGWWPAAQGDQYDWGYCH------------------------------------MNYNYGLCGDDLNLPLLQEPELVETDPFIAFKTALWFWMTP-QSPKPSCHAVITESWTPSAADSEAGRVPGYGVITNIINGGIECGQGGPNNANENRIGFYKTYCDSLGT---TYGSN--LDCYQQRPF 292          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: AGI_URTDI (Lectin/endochitinase 1 OS=Urtica dioica GN=UDA1 PE=1 SV=3)

HSP 1 Score: 116.701 bits (291), Expect = 3.295e-25
Identity = 71/224 (31.70%), Postives = 115/224 (51.34%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQS-YCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGV 936
            F+  FS R      + GF+ Y SF+ A   +    FGT G    + +E+ AFLAH+   TS G       P AWGLC+ +  + +++ +C  S    +PC  G +Y  RG I +  N+NYG  G+A+  DL+ +P+ +E++  ++F+ A+W WM+    ++PS HD  +        ++ + R PN G   NI+      G  D    ++ +  Y  Y D+LGV
Sbjct:  139 FDQMFSHRKD--CPSQGFYSYHSFLVAAESFP--AFGTIGDVATRKREVAAFLAHISQATS-GERSDVENPHAWGLCHINTTTVTENDFCTSS---DWPCAAGKKYSPRGPIQLTHNFNYGLAGQAIGEDLIQNPDLVEKDPIISFKTALWFWMSQ-HDNKPSCHDIVL------NANSAANRIPNKGVIGNII--SRAFGHDDFAVRSSSIGFYKRYCDMLGV 345          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI6_ORYSJ (Chitinase 6 OS=Oryza sativa subsp. japonica GN=Cht6 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 1.060e-23
Identity = 72/223 (32.29%), Postives = 104/223 (46.64%), Query Frame = 1
Query:  310 AVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMS-PSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSC 975
            A GF+   +F+TA   Y    FG TG+  D  +EI AF AH   +T                CY  E+  PS++YCD++    +PC  G  YYGRG + I WN+NYG  G+++  D L  P+ + ++  LAF+ A+W W   V       HDAFV              G  FG T+  + G   C   +  A++N V++Y  +    GV      P   L+C
Sbjct:   90 AKGFYTRDAFLTAAGGYP--SFGRTGSVDDSKREIAAFFAHANHETI-------------KFCYIEEIDGPSKNYCDET-STQWPCMAGKGYYGRGPLQISWNFNYGPAGQSIGFDGLGDPDAVARSPVLAFQTALWYWTNNV-------HDAFVS-------------GQGFGATIRAINGALECDGKNPTAVSNRVAYYQQFCQQFGV-----DPGSNLTC 271          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIB_MAIZE (Endochitinase B (Fragment) OS=Zea mays PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 2.887e-21
Identity = 70/219 (31.96%), Postives = 97/219 (44.29%), Query Frame = 1
Query:  319 FWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSC 975
            F+   +F++A   Y   GF   G+++   +EI AF AH   +T                CY  E++ S +YCD + K  +PC  G +YYGRG + I WNYNYG  G A+  D L  P  + ++A +AF+AA+W WM  V    P                        FG T   +     CG  +   MN  V +Y  Y   LGV     GPN  L+C
Sbjct:   94 FYTRSAFLSAVKGYP--GFAHGGSQVQGKREIAAFFAHATHETG-------------HFCYISEINKSNAYCDPT-KRQWPCAAGQKYYGRGPLQISWNYNYGPAGRAIGFDGLGDPGRVARDAVVAFKAALWFWMNSVHGVVPQ----------------------GFGATTRAMQRALECGGNNPAQMNARVGYYRQYCRQLGV---DPGPN--LTC 269          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI5_ORYSJ (Chitinase 5 OS=Oryza sativa subsp. japonica GN=Cht5 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 4.924e-21
Identity = 67/207 (32.37%), Postives = 95/207 (45.89%), Query Frame = 1
Query:  319 FWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMS-PSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGV 936
            F+  QSF+ A   Y   GF    T  D  +EI AF AHV  +T               +CY +E++  S  YCD + K  +PC PG +YYGRG + I WNYNYG  G+ +  D L  P+ + Q+ T++F+ A+W WM  V       H   +                 FG T+  + G   C   +  A+N  V++Y  Y    GV
Sbjct:  112 FYTRQSFLNAAHSYS--GFARDRTNDDSKREIAAFFAHVTHETG-------------HMCYINEINGASMDYCDKNNKQ-WPCQPGKKYYGRGPLQISWNYNYGPAGQNIGFDGLRDPDRVAQDPTISFKTALWFWMNNV-------HQVML---------------QGFGATIRAINGALECNGKNPGAVNARVNYYKDYCRQFGV 280          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIA_MAIZE (Endochitinase A OS=Zea mays PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 6.431e-21
Identity = 67/214 (31.31%), Postives = 94/214 (43.93%), Query Frame = 1
Query:  319 FWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPN 960
            F+   +F++A   Y   GF   GT+++  +EI AF AHV  +T                CY  E++ S +YCD S +  +PC  G +YYGRG + I WNYNYG  G  +  + L  P  + Q+A +AF+ A+W WM  V    P                        FG T+  + G   C   +   MN  V +Y  Y   L   R   GPN
Sbjct:  105 FYTRSAFLSAVNAYP--GFAHGGTEVEGKREIAAFFAHVTHETG-------------HFCYISEINKSNAYCDASNRQ-WPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVAQDAVIAFKTALWFWMNNVHGVMPQ----------------------GFGATIRAINGALECNGNNPAQMNARVGYYKQYCQQL---RVDPGPN 277          
The following BLAST results are available for this feature:
BLAST of DC900363 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
CHI8_ORYSJ1.429e-2831.69Chitinase 8 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIT_AVESA2.064e-2733.00Endochitinase (Fragments) OS=Avena sativa PE=1 SV=... [more]
CHIA_SOLLC6.005e-2730.74Acidic 26 kDa endochitinase OS=Solanum lycopersicu... [more]
CHIA_SOLCI7.843e-2731.15Acidic endochitinase pcht28 OS=Solanum chilense PE... [more]
CHIB_POPTR2.282e-2631.35Acidic endochitinase WIN6.2B OS=Populus trichocarp... [more]
AGI_URTDI3.295e-2531.70Lectin/endochitinase 1 OS=Urtica dioica GN=UDA1 PE... [more]
CHI6_ORYSJ1.060e-2332.29Chitinase 6 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIB_MAIZE2.887e-2131.96Endochitinase B (Fragment) OS=Zea mays PE=1 SV=1[more]
CHI5_ORYSJ4.924e-2132.37Chitinase 5 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIA_MAIZE6.431e-2131.31Endochitinase A OS=Zea mays PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900363 VSS Citrus sinensis cDNA clone VS28931 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900363 ID=DC900363|Name=DC900363|organism=Citrus sinensis|type=EST|length=1374bp
CTCATCTTCCCCCAAGTGAATCTCGAAACAACAGGTAGATCTGGTGAGAA
CGAGAAAATGAAGATGAAGAATGGCAGTGTGGCAATGACACTGACAGTGG
CACTAGTACTGGCACTGGCAGTGAGTTTGGCAAATGGAGATGAATCAGAG
AAGGTGATAGTGAAGAAGTTGAAGGGGAAAAAAGTTTGCATAAAAGGGTG
GGAGTGCCCAACATGGTCGAAATTCTGCTGTAACGAGACGATATCAGACT
ATTTCCAGGTTTACCAGTTTGAGAATTTCTTCTCGAAAAGGAACACGCCG
GTGGCACATGCCGTGGGATTCTGGGATTATCAGTCTTTCATTACTGCCAC
CGTCAAATATCAGCCCCTCGGCTTCGGTACCACCGGTACTAAGCTTGATA
AGATGAAGGAGATTTGCGCTTTTCTTGCCCACGTGGGCTGCAAGACCTCT
TGTGGATATGGAGTGGCCACTGGAGGACCATTGGCCTGGGGACTTTGCTA
CAACCATGAAATGAGCCCCAGTCAGTCATATTGTGATGATTCCTACAAAT
ACACATATCCCTGCACCCCTGGAGCTGAGTACTATGGCCGAGGTGCTATA
CCTATATACTGGAACTATAACTATGGAGCCACTGGGGAAGCATTGAAGGC
AGATCTGTTGAATCATCCCGAATACATTGAGCAGAATGCTACCCTTGCCT
TTGAGGCTGCAATTTGGAAGTGGATGACCCCAGTCAAGAAATCCCAGCCT
TCAGCCCATGATGCCTTTGTTGGCAACTGGAAGCCCACCAAGAATGATAC
TTTGTCCAAACGGGGACCTAACTTTGGTACCACAATGAATATCCTCTATG
GTGAGAGCGTATGCGGTCAGGGTGATATTGATGCTATGAACAACATTGTC
TCTCATTACTTGTATTACCTTGATCTGTTGGGTGTTGGCCGAGAGCAGGC
AGGACCTAATGAAGAACTCTCTTGTGCTGAGCAGAAAGCCTTCAACCCAA
ACACCGCACCTTCAGCTGCATCTTCTTGAGGACGTTTATTGTAGCCAAGC
TATTATTGTGGGAGTGACTCTCTCTCTCTCTCTAGGTGGGTACCATTACA
ATAAGACTGGGGTTAATTAAACTATTTGTTGTAAGTTTTTTTTTTTTTTT
CCATCTTTTCATATATTGCGCAAGGTCAATTAGTGTGTGGATTGGTCTGC
CCCTCTTCATTGCCGTTGTAGATTTGAGATTCATTTGGTTTGTAAAATCT
TCGTTATATCTGGTTACATATGTAATGATGAACCGCATGAACCACTCGTG
TGTTTCAATAGCAGAATTGTAAAGTATATGCTTATATTTTATTTATTCCG
GGATATCGACTCCTAGTTTCGTTT
back to top