DC900357

Overview
NameDC900357
Unique NameDC900357
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length547
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6192 contig Csv1_Contig6192:89..636. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTA_PHYPO (Actin, plasmodial isoform OS=Physarum polycephalum GN=ARDA PE=1 SV=2)

HSP 1 Score: 274.633 bits (701), Expect = 2.087e-73
Identity = 130/139 (93.53%), Postives = 135/139 (97.12%), Query Frame = 3
Query:   75 DGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            +GED+Q LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    2 EGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT10_DICDI (Actin-10 OS=Dictyostelium discoideum GN=act10 PE=1 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 2.087e-73
Identity = 130/139 (93.53%), Postives = 135/139 (97.12%), Query Frame = 3
Query:   75 DGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            +GED+Q LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    2 EGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT_MESVI (Actin OS=Mesostigma viride PE=3 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 3.560e-73
Identity = 130/141 (92.20%), Postives = 135/141 (95.74%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MAD  ++  L+CDNG+GMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MADEGEVSALMCDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT_CHLRE (Actin OS=Chlamydomonas reinhardtii PE=2 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 4.649e-73
Identity = 129/141 (91.49%), Postives = 136/141 (96.45%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MAD  ++  LVCDNG+GMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKD+YVGDEAQSKRGILTL+YPIEHGIV+NWDDMEKIWHHTF+NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MADEGEVSALVCDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFFNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT_VOLCA (Actin OS=Volvox carteri PE=3 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 1.353e-72
Identity = 128/141 (90.78%), Postives = 136/141 (96.45%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MA+  ++  LVCDNG+GMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKD+YVGDEAQSKRGILTL+YPIEHGIV+NWDDMEKIWHHTF+NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MAEEGEVSALVCDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFFNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTS_CARAU (Actin, alpha skeletal muscle OS=Carassius auratus GN=acta1 PE=2 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 1.353e-72
Identity = 127/141 (90.07%), Postives = 134/141 (95.04%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M D E++  LVCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MCDDEEVTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTS_ATRMM (Actin, alpha skeletal muscle OS=Atractaspis microlepidota microlepidota GN=ACTA1 PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 1.767e-72
Identity = 127/143 (88.81%), Postives = 134/143 (93.71%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVFP 497
            M D ++   LVCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV P
Sbjct:    1 MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLP 143          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT1_ACACA (Actin-1 OS=Acanthamoeba castellanii PE=3 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 2.307e-72
Identity = 128/138 (92.75%), Postives = 134/138 (97.10%), Query Frame = 3
Query:   78 GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            G+++Q LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    2 GDEVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 139          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTS_ORYLA (Actin, alpha skeletal muscle OS=Oryzias latipes GN=acta1 PE=2 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 3.936e-72
Identity = 127/141 (90.07%), Postives = 133/141 (94.33%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M D E+   LVCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTC_XENLA (Actin, alpha cardiac muscle 1 OS=Xenopus laevis GN=actc1 PE=2 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 3.936e-72
Identity = 127/141 (90.07%), Postives = 133/141 (94.33%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M D E+   LVCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
The following BLAST results are available for this feature:
BLAST of DC900357 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 444
Match NameE-valueIdentityDescription
ACTA_PHYPO2.087e-7393.53Actin, plasmodial isoform OS=Physarum polycephalum... [more]
ACT10_DICDI2.087e-7393.53Actin-10 OS=Dictyostelium discoideum GN=act10 PE=1... [more]
ACT_MESVI3.560e-7392.20Actin OS=Mesostigma viride PE=3 SV=1[more]
ACT_CHLRE4.649e-7391.49Actin OS=Chlamydomonas reinhardtii PE=2 SV=1[more]
ACT_VOLCA1.353e-7290.78Actin OS=Volvox carteri PE=3 SV=1[more]
ACTS_CARAU1.353e-7290.07Actin, alpha skeletal muscle OS=Carassius auratus ... [more]
ACTS_ATRMM1.767e-7288.81Actin, alpha skeletal muscle OS=Atractaspis microl... [more]
ACT1_ACACA2.307e-7292.75Actin-1 OS=Acanthamoeba castellanii PE=3 SV=1[more]
ACTS_ORYLA3.936e-7290.07Actin, alpha skeletal muscle OS=Oryzias latipes GN... [more]
ACTC_XENLA3.936e-7290.07Actin, alpha cardiac muscle 1 OS=Xenopus laevis GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900357 VSS Citrus sinensis cDNA clone VS28919 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900357 ID=DC900357|Name=DC900357|organism=Citrus sinensis|type=EST|length=547bp
CTCGTGCCGAATTCGGCACGAGGCGCCTCGTAATTCGCTCGTTCTCATCT
CATAACCGGTAGCAGAAGATGGCAGACGGTGAGGATATTCAGCCACTTGT
TTGTGATAATGGAACAGGAATGGTTAAGGCTGGGTTTGCCGGAGATGATG
CTCCACGGGCGGTGTTCCCCAGTATTGTTGGTCGTCCACGTCACACTGGT
GTGATGGTTGGCATGGGTCAGAAGGATGCGTATGTTGGTGATGAGGCTCA
ATCGAAGAGAGGTATTTTGACTTTGAAATACCCCATTGAGCATGGTATTG
TGAGCAACTGGGATGACATGGAGAAGATCTGGCATCACACCTTCTACAAT
GAGCTTCGTGTTGCCCCTGAAGAGCACCCTGTTCTTCTTACTGAGGCTCC
TCTCAATCCGAAGGCTAATCGCGAGAAGATGACCCAGATTATGTTTGAGA
CCTTTAATGCTCCCGCTATGTATGTTGCCATCCAGGCCGTCTTTCCTTGT
ATGCGAGTGGTCGTCCACTGGTATTGTGTGACTCTGTGATGGGTGAG
back to top