DC900357

Overview
NameDC900357
Unique NameDC900357
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length547
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6192 contig Csv1_Contig6192:89..636. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTS_BOVIN (Actin, alpha skeletal muscle OS=Bos taurus GN=ACTA1 PE=1 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 1.145e-71
Identity = 126/141 (89.36%), Postives = 133/141 (94.33%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M D ++   LVCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT1_MAIZE (Actin-1 OS=Zea mays GN=ACT1 PE=3 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 1.145e-71
Identity = 130/141 (92.20%), Postives = 136/141 (96.45%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MAD EDIQP+VCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQ+KRGILTLKYPIEHGIV+NWDDME  WHHTFYNELRV+PE+HPVLLTEAPLNPKANREKMTQIMFETF  PAMYVAI+AV
Sbjct:    1 MAD-EDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQAKRGILTLKYPIEHGIVNNWDDMEN-WHHTFYNELRVSPEDHPVLLTEAPLNPKANREKMTQIMFETFECPAMYVAIEAV 139          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT2_HALRO (Actin, muscle 2/4/4A OS=Halocynthia roretzi GN=MA2 PE=2 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.496e-71
Identity = 127/142 (89.44%), Postives = 135/142 (95.07%), Query Frame = 3
Query:   69 MADGE-DIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M+DGE D   +VCDNG+G+VK+GFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MSDGEEDTTAIVCDNGSGLVKSGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 142          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTF_STRPU (Actin, cytoskeletal 3B OS=Strongylocentrotus purpuratus GN=CYIIIB PE=2 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 1.953e-71
Identity = 127/137 (92.70%), Postives = 133/137 (97.08%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            +D+  LV DNG+GMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    4 DDVAALVVDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTE_STRPU (Actin, cytoskeletal 3A OS=Strongylocentrotus purpuratus GN=CYIIIA PE=3 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 1.953e-71
Identity = 127/137 (92.70%), Postives = 133/137 (97.08%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            +D+  LV DNG+GMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    4 DDVAALVVDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTD_STRPU (Actin, cytoskeletal 2B OS=Strongylocentrotus purpuratus GN=CYIIB PE=2 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 1.953e-71
Identity = 127/137 (92.70%), Postives = 133/137 (97.08%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            +D+  LV DNG+GMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    4 DDVAALVIDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTC_STRPU (Actin, cytoskeletal 2A OS=Strongylocentrotus purpuratus GN=CYIIA PE=2 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 1.953e-71
Identity = 127/137 (92.70%), Postives = 133/137 (97.08%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            +D+  LV DNG+GMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    4 DDVAALVVDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT2_STRFN (Actin-15B OS=Strongylocentrotus franciscanus PE=2 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 1.953e-71
Identity = 127/137 (92.70%), Postives = 133/137 (97.08%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            +D+  LV DNG+GMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    4 DDVAALVIDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT2_MOLOC (Actin, muscle-type OS=Molgula oculata PE=3 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 1.953e-71
Identity = 129/142 (90.85%), Postives = 135/142 (95.07%), Query Frame = 3
Query:   69 MADGEDIQP-LVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M D E+ Q  LVCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MEDEEEEQTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 142          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT1_STRFN (Actin-15A OS=Strongylocentrotus franciscanus PE=3 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 1.953e-71
Identity = 127/137 (92.70%), Postives = 133/137 (97.08%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            +D+  LV DNG+GMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    4 DDVAALVIDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 140          
The following BLAST results are available for this feature:
BLAST of DC900357 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 444
Match NameE-valueIdentityDescription
ACTS_BOVIN1.145e-7189.36Actin, alpha skeletal muscle OS=Bos taurus GN=ACTA... [more]
ACT1_MAIZE1.145e-7192.20Actin-1 OS=Zea mays GN=ACT1 PE=3 SV=1[more]
ACT2_HALRO1.496e-7189.44Actin, muscle 2/4/4A OS=Halocynthia roretzi GN=MA2... [more]
ACTF_STRPU1.953e-7192.70Actin, cytoskeletal 3B OS=Strongylocentrotus purpu... [more]
ACTE_STRPU1.953e-7192.70Actin, cytoskeletal 3A OS=Strongylocentrotus purpu... [more]
ACTD_STRPU1.953e-7192.70Actin, cytoskeletal 2B OS=Strongylocentrotus purpu... [more]
ACTC_STRPU1.953e-7192.70Actin, cytoskeletal 2A OS=Strongylocentrotus purpu... [more]
ACT2_STRFN1.953e-7192.70Actin-15B OS=Strongylocentrotus franciscanus PE=2 ... [more]
ACT2_MOLOC1.953e-7190.85Actin, muscle-type OS=Molgula oculata PE=3 SV=1[more]
ACT1_STRFN1.953e-7192.70Actin-15A OS=Strongylocentrotus franciscanus PE=3 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900357 VSS Citrus sinensis cDNA clone VS28919 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900357 ID=DC900357|Name=DC900357|organism=Citrus sinensis|type=EST|length=547bp
CTCGTGCCGAATTCGGCACGAGGCGCCTCGTAATTCGCTCGTTCTCATCT
CATAACCGGTAGCAGAAGATGGCAGACGGTGAGGATATTCAGCCACTTGT
TTGTGATAATGGAACAGGAATGGTTAAGGCTGGGTTTGCCGGAGATGATG
CTCCACGGGCGGTGTTCCCCAGTATTGTTGGTCGTCCACGTCACACTGGT
GTGATGGTTGGCATGGGTCAGAAGGATGCGTATGTTGGTGATGAGGCTCA
ATCGAAGAGAGGTATTTTGACTTTGAAATACCCCATTGAGCATGGTATTG
TGAGCAACTGGGATGACATGGAGAAGATCTGGCATCACACCTTCTACAAT
GAGCTTCGTGTTGCCCCTGAAGAGCACCCTGTTCTTCTTACTGAGGCTCC
TCTCAATCCGAAGGCTAATCGCGAGAAGATGACCCAGATTATGTTTGAGA
CCTTTAATGCTCCCGCTATGTATGTTGCCATCCAGGCCGTCTTTCCTTGT
ATGCGAGTGGTCGTCCACTGGTATTGTGTGACTCTGTGATGGGTGAG
back to top