DC900357

Overview
NameDC900357
Unique NameDC900357
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length547
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6192 contig Csv1_Contig6192:89..636. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT1_HELTB (Actin CyI, cytoplasmic OS=Heliocidaris tuberculata PE=3 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 1.953e-71
Identity = 127/137 (92.70%), Postives = 133/137 (97.08%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            +D+  LV DNG+GMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    4 DDVAALVIDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT1_HELER (Actin CyI, cytoplasmic OS=Heliocidaris erythrogramma PE=3 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 1.953e-71
Identity = 127/137 (92.70%), Postives = 133/137 (97.08%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            +D+  LV DNG+GMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    4 DDVAALVIDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT_CRAGI (Actin OS=Crassostrea gigas PE=2 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 2.551e-71
Identity = 128/137 (93.43%), Postives = 132/137 (96.35%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            EDI  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    4 EDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTSB_TAKRU (Actin, alpha skeletal muscle B OS=Takifugu rubripes GN=acta1b PE=2 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 2.551e-71
Identity = 125/141 (88.65%), Postives = 133/141 (94.33%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M D ++   LVCDNG+G+VKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MCDDDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT3_DIPDE (Actin-3 OS=Diphyllobothrium dendriticum GN=ACT3 PE=2 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 2.551e-71
Identity = 128/141 (90.78%), Postives = 134/141 (95.04%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MA  ED+  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI+FETFN+PAMYVAIQAV
Sbjct:    1 MAFNEDVGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIVFETFNSPAMYVAIQAV 141          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTM_PISOC (Actin, muscle OS=Pisaster ochraceus PE=3 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 3.332e-71
Identity = 127/137 (92.70%), Postives = 132/137 (96.35%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            ED+  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    4 EDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTB_XENBO (Actin, cytoplasmic 1 OS=Xenopus borealis GN=actb PE=3 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 3.332e-71
Identity = 130/141 (92.20%), Postives = 134/141 (95.04%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MAD +DI  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MAD-DDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT3_PODCA (Actin-3 OS=Podocoryne carnea GN=ACT3 PE=3 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 3.332e-71
Identity = 129/141 (91.49%), Postives = 135/141 (95.74%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MAD +D+  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    1 MAD-DDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT3_DICDI (Actin-3 OS=Dictyostelium discoideum GN=act3 PE=3 SV=3)

HSP 1 Score: 267.314 bits (682), Expect = 3.332e-71
Identity = 125/139 (89.93%), Postives = 134/139 (96.40%), Query Frame = 3
Query:   75 DGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            + ED+Q LV DNG+GM KAGFAGDDAPRAVFPSIVGRPR+TGVMVGMGQKD+Y+GDEAQS++GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    2 ESEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRYTGVMVGMGQKDSYIGDEAQSRKGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT2_SCHMA (Actin-2 OS=Schistosoma mansoni PE=2 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 3.332e-71
Identity = 129/141 (91.49%), Postives = 134/141 (95.04%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MAD E++Q LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYV IQAV
Sbjct:    1 MAD-EEVQALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVGIQAV 140          
The following BLAST results are available for this feature:
BLAST of DC900357 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 444
Match NameE-valueIdentityDescription
ACT1_HELTB1.953e-7192.70Actin CyI, cytoplasmic OS=Heliocidaris tuberculata... [more]
ACT1_HELER1.953e-7192.70Actin CyI, cytoplasmic OS=Heliocidaris erythrogram... [more]
ACT_CRAGI2.551e-7193.43Actin OS=Crassostrea gigas PE=2 SV=1[more]
ACTSB_TAKRU2.551e-7188.65Actin, alpha skeletal muscle B OS=Takifugu rubripe... [more]
ACT3_DIPDE2.551e-7190.78Actin-3 OS=Diphyllobothrium dendriticum GN=ACT3 PE... [more]
ACTM_PISOC3.332e-7192.70Actin, muscle OS=Pisaster ochraceus PE=3 SV=1[more]
ACTB_XENBO3.332e-7192.20Actin, cytoplasmic 1 OS=Xenopus borealis GN=actb P... [more]
ACT3_PODCA3.332e-7191.49Actin-3 OS=Podocoryne carnea GN=ACT3 PE=3 SV=1[more]
ACT3_DICDI3.332e-7189.93Actin-3 OS=Dictyostelium discoideum GN=act3 PE=3 S... [more]
ACT2_SCHMA3.332e-7191.49Actin-2 OS=Schistosoma mansoni PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900357 VSS Citrus sinensis cDNA clone VS28919 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900357 ID=DC900357|Name=DC900357|organism=Citrus sinensis|type=EST|length=547bp
CTCGTGCCGAATTCGGCACGAGGCGCCTCGTAATTCGCTCGTTCTCATCT
CATAACCGGTAGCAGAAGATGGCAGACGGTGAGGATATTCAGCCACTTGT
TTGTGATAATGGAACAGGAATGGTTAAGGCTGGGTTTGCCGGAGATGATG
CTCCACGGGCGGTGTTCCCCAGTATTGTTGGTCGTCCACGTCACACTGGT
GTGATGGTTGGCATGGGTCAGAAGGATGCGTATGTTGGTGATGAGGCTCA
ATCGAAGAGAGGTATTTTGACTTTGAAATACCCCATTGAGCATGGTATTG
TGAGCAACTGGGATGACATGGAGAAGATCTGGCATCACACCTTCTACAAT
GAGCTTCGTGTTGCCCCTGAAGAGCACCCTGTTCTTCTTACTGAGGCTCC
TCTCAATCCGAAGGCTAATCGCGAGAAGATGACCCAGATTATGTTTGAGA
CCTTTAATGCTCCCGCTATGTATGTTGCCATCCAGGCCGTCTTTCCTTGT
ATGCGAGTGGTCGTCCACTGGTATTGTGTGACTCTGTGATGGGTGAG
back to top