DC900357

Overview
NameDC900357
Unique NameDC900357
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length547
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6192 contig Csv1_Contig6192:89..636. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT2_LUMTE (Actin-2 OS=Lumbricus terrestris GN=ACT2 PE=2 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 3.332e-71
Identity = 127/137 (92.70%), Postives = 132/137 (96.35%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            ED+  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    4 EDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACT1_PODCA (Actin-1/2 OS=Podocoryne carnea GN=ACTIA PE=2 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 3.332e-71
Identity = 129/141 (91.49%), Postives = 135/141 (95.74%), Query Frame = 3
Query:   69 MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            MAD +D+  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAV
Sbjct:    1 MAD-DDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTY_LIMPO (Actin-11 OS=Limulus polyphemus PE=2 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 4.351e-71
Identity = 127/137 (92.70%), Postives = 131/137 (95.62%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            ED+  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    4 EDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTM_CIOSA (Actin, muscle OS=Ciona savignyi PE=2 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 4.351e-71
Identity = 127/142 (89.44%), Postives = 135/142 (95.07%), Query Frame = 3
Query:   69 MADGEDIQP-LVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            M+D E+ Q  LVCDNG+G+VK+GFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI++NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    1 MSDSEEDQTALVCDNGSGLVKSGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV 142          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTC_PISOC (Actin, cytoplasmic OS=Pisaster ochraceus PE=3 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 4.351e-71
Identity = 127/137 (92.70%), Postives = 131/137 (95.62%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            ED+  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    4 EDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTC_HELTI (Actin, cytoplasmic OS=Helisoma trivolvis PE=3 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 4.351e-71
Identity = 127/137 (92.70%), Postives = 131/137 (95.62%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            ED+  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    4 EDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTC_HALRO (Actin, nonmuscle OS=Halocynthia roretzi GN=CA1 PE=3 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 4.351e-71
Identity = 127/137 (92.70%), Postives = 131/137 (95.62%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            ED+  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    4 EDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTC_BIOTE (Actin, cytoplasmic OS=Biomphalaria tenagophila PE=3 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 4.351e-71
Identity = 127/137 (92.70%), Postives = 131/137 (95.62%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            ED+  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    4 EDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTC_BIOPF (Actin, cytoplasmic OS=Biomphalaria pfeifferi PE=3 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 4.351e-71
Identity = 127/137 (92.70%), Postives = 131/137 (95.62%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            ED+  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    4 EDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
BLAST of DC900357 vs. ExPASy Swiss-Prot
Match: ACTC_BIOOB (Actin, cytoplasmic OS=Biomphalaria obstructa PE=3 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 4.351e-71
Identity = 127/137 (92.70%), Postives = 131/137 (95.62%), Query Frame = 3
Query:   81 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAV 491
            ED+  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAV
Sbjct:    4 EDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 140          
The following BLAST results are available for this feature:
BLAST of DC900357 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 444
Match NameE-valueIdentityDescription
ACT2_LUMTE3.332e-7192.70Actin-2 OS=Lumbricus terrestris GN=ACT2 PE=2 SV=1[more]
ACT1_PODCA3.332e-7191.49Actin-1/2 OS=Podocoryne carnea GN=ACTIA PE=2 SV=1[more]
ACTY_LIMPO4.351e-7192.70Actin-11 OS=Limulus polyphemus PE=2 SV=1[more]
ACTM_CIOSA4.351e-7189.44Actin, muscle OS=Ciona savignyi PE=2 SV=1[more]
ACTC_PISOC4.351e-7192.70Actin, cytoplasmic OS=Pisaster ochraceus PE=3 SV=1[more]
ACTC_HELTI4.351e-7192.70Actin, cytoplasmic OS=Helisoma trivolvis PE=3 SV=1[more]
ACTC_HALRO4.351e-7192.70Actin, nonmuscle OS=Halocynthia roretzi GN=CA1 PE=... [more]
ACTC_BIOTE4.351e-7192.70Actin, cytoplasmic OS=Biomphalaria tenagophila PE=... [more]
ACTC_BIOPF4.351e-7192.70Actin, cytoplasmic OS=Biomphalaria pfeifferi PE=3 ... [more]
ACTC_BIOOB4.351e-7192.70Actin, cytoplasmic OS=Biomphalaria obstructa PE=3 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900357 VSS Citrus sinensis cDNA clone VS28919 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900357 ID=DC900357|Name=DC900357|organism=Citrus sinensis|type=EST|length=547bp
CTCGTGCCGAATTCGGCACGAGGCGCCTCGTAATTCGCTCGTTCTCATCT
CATAACCGGTAGCAGAAGATGGCAGACGGTGAGGATATTCAGCCACTTGT
TTGTGATAATGGAACAGGAATGGTTAAGGCTGGGTTTGCCGGAGATGATG
CTCCACGGGCGGTGTTCCCCAGTATTGTTGGTCGTCCACGTCACACTGGT
GTGATGGTTGGCATGGGTCAGAAGGATGCGTATGTTGGTGATGAGGCTCA
ATCGAAGAGAGGTATTTTGACTTTGAAATACCCCATTGAGCATGGTATTG
TGAGCAACTGGGATGACATGGAGAAGATCTGGCATCACACCTTCTACAAT
GAGCTTCGTGTTGCCCCTGAAGAGCACCCTGTTCTTCTTACTGAGGCTCC
TCTCAATCCGAAGGCTAATCGCGAGAAGATGACCCAGATTATGTTTGAGA
CCTTTAATGCTCCCGCTATGTATGTTGCCATCCAGGCCGTCTTTCCTTGT
ATGCGAGTGGTCGTCCACTGGTATTGTGTGACTCTGTGATGGGTGAG
back to top