DC900346

Overview
NameDC900346
Unique NameDC900346
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length848
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: ROD1_RAT (Regulator of differentiation 1 OS=Rattus norvegicus GN=Rod1 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 7.667e-39
Identity = 108/310 (34.84%), Postives = 153/310 (49.35%), Query Frame = 2
Query:    8 LQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGR------------------------------GDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPS---------------QSGYSEA-----GVAFPQ------------MXXXXXXXXXFGGGLP-PGITGTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLLRNKPDHALXQMGDGXQAELAXHFLKG 748
            + +YT V P +R + VY+Q+S+H+EL T     Q R                              G  P  +L + I ++ YP+T+EVLHQ+FS  G V KI+TF K+  FQAL+QY    +A  A+ +L G+NIY+ CC L I FS L  L V YNN++SRDFT  +LP    G+PS                S Y+ A      +AFPQ            +           G +  PG +G      +LV+NLN D I    LF L  +YG++ R+K++ NK ++AL QM D  QA++A + L G
Sbjct:   82 INYYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNLSLPGATSNEGTLLPGQSP--VLRIIIENLFYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAQYAKMALDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDFTRLDLPTGD-GQPSLEPPMAAAFGAPGIMSSPYAGAAGFAPAIAFPQAAGLSVSAVPGALGPLTLTSSAVSGRMAIPGASGIPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQAQIAMNHLSG 388          
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: ROD1_HUMAN (Regulator of differentiation 1 OS=Homo sapiens GN=ROD1 PE=1 SV=2)

HSP 1 Score: 159.073 bits (401), Expect = 2.914e-38
Identity = 107/310 (34.52%), Postives = 150/310 (48.39%), Query Frame = 2
Query:    8 LQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGR------------------------------GDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPS---------------QSGYSEA-----GVAFPQM-------------XXXXXXXXXFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLLRNKPDHALXQMGDGXQAELAXHFLKG 748
            + +YT + P +R + VY+Q+S+H+EL T     Q R                              G  P  +L + I ++ YP+T+EVLHQ+FS  G V KI+TF K+  FQAL+QY    +A  A+ +L G+NIY+ CC L I FS L  L V YNN++SRDFT  +LP    G+PS                S Y+ A      + FPQ                        G    PG +G      +LV+NLN D I    LF L  +YG++ R+K++ NK ++AL QM D  QA+LA + L G
Sbjct:  111 VNYYTPITPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGSLALSGGPSNEGTVLPGQSP--VLRIIIENLFYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAHYAKMALDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDFTRLDLPTGD-GQPSLEPPMAAAFGAPGIISSPYAGAAGFAPAIGFPQATGLSVPAVPGALGPLTITSSAVTGRMAIPGASGIPGNSVLLVTNLNPDLITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADANQAQLAMNHLSG 417          
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: PTBP1_ARATH (Polypyrimidine tract-binding protein homolog 1 OS=Arabidopsis thaliana GN=PTB PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.075e-24
Identity = 79/246 (32.11%), Postives = 123/246 (50.00%), Query Frame = 2
Query:   38 IRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHM-LYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNI-------YDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAGVAFPQMXXXXXXXXXFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLL-RNKPDHALXQMGDGXQAELAXHFLKG 748
            IRG+ VY+Q+S+  E+     N Q  GD P  +LLVT   +  + ++++V+H VFS  GFV KI TF+K+AGFQAL+Q+    +A  ARS+L GR+I       + G C L + +S   +L + + + RSRD+TNP LP  Q    +  G  +  +                G     +   ++    L+ N+    +  D L  + S YG + +I +  +N    AL Q  D   A +A   L+G
Sbjct:   83 IRGKTVYIQYSNRHEIV----NNQSPGDVPGNVLLVTFEGVESHEVSIDVIHLVFSAFGFVHKIATFEKAAGFQALVQFTDVETASAARSALDGRSIPRYLLSAHVGSCSLRMSYSAHTDLNIKFQSHRSRDYTNPYLPVNQ---TAMDGSMQPAL----------------GADGKKVESQSNVLLGLIENMQY-AVTVDVLHTVFSAYGTVQKIAIFEKNGSTQALIQYSDIPTAAMAKEALEG 304          

HSP 2 Score: 90.5077 bits (223), Expect = 1.273e-17
Identity = 52/128 (40.62%), Postives = 76/128 (59.38%), Query Frame = 2
Query:  119 DEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYD-GCCQLDIQFSNLDELQVNYNNERSRDFTNPNLP--AEQKGRPSQSGYSEAGVAFPQ 493
            +  + +LL  I +M Y +TV+VLH VFS +G V+KI  F+K+   QALIQY   P+A +A+ +L+G  IYD G C+L + +S   +L V   +++SRD+T P+L     QKG         AG   PQ
Sbjct:  239 ESQSNVLLGLIENMQYAVTVDVLHTVFSAYGTVQKIAIFEKNGSTQALIQYSDIPTAAMAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKAFSDKSRDYTLPDLSLLVAQKGPAVSGSAPPAGWQNPQ 366          
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: HNRLL_MOUSE (Heterogeneous nuclear ribonucleoprotein L-like OS=Mus musculus GN=Hnrpll PE=1 SV=3)

HSP 1 Score: 114.005 bits (284), Expect = 1.075e-24
Identity = 80/265 (30.19%), Postives = 131/265 (49.43%), Query Frame = 2
Query:   14 FYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEP---NRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPSQ--------------SGYSEAGVAFP----QMXXXXXXXXXFGGGLPPGIT-----GTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLLRNKPDHALXQMGDGXQAELA 730
            F  +V   I G+  +  +S+ + +T       G  D+P   N++LL++I + LYPITV+VL+ V +P G V++IV F+++ G QA+++++    A  A+++L G +IY GCC L I+++    L V  N+  S D+T P L    +G+  Q               GY   G   P                   LP   +     G+     V+VS L+  +++  ++FNL  LYGNI ++K ++  P  AL +MGD    E A
Sbjct:  179 FAADVPVYIAGQQAFFNYSTSKRITR-----PGNTDDPSGGNKVLLLSIQNPLYPITVDVLYTVCNPVGKVQRIVIFKRN-GIQAMVEFESVLCAQKAKAALNGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYTKPYLGRRDRGKGRQRQAILGDHPSSFRHDGYGSHGPLLPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGSPSGSVVMVSGLHQLKMNCSRVFNLFCLYGNIEKVKFMKTIPGTALVEMGDEYAVERA 437          
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: HNRPL_MOUSE (Heterogeneous nuclear ribonucleoprotein L OS=Mus musculus GN=Hnrnpl PE=1 SV=2)

HSP 1 Score: 113.235 bits (282), Expect = 1.833e-24
Identity = 82/295 (27.80%), Postives = 137/295 (46.44%), Query Frame = 2
Query:    2 NALQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNL-----------------------PAEQKGRPS--QSGYSEAGVAFPQMXXXXXXXXXFGGG-------------------LPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLLRNKPDHALXQMGDGXQAELAXHFLKGXY 754
            NA+ +  + Q  I G   +V +S+ Q+++    +   R    N +LL TI + +Y IT +VL+ + +P G V++IV F+K+ G QA++++    SA  A++SL G +IY GCC L I+++    L V  N++ + D+TNPNL                       PAE  G      S Y + G   P             GG                    PP      D   ++V  L+  +++ D++FN+  LYGN+ ++K +++KP  A+ +M DG   + A   L   +
Sbjct:  149 NAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRS--VNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKN-GVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGHRRGPSRYGPQYGHPPPPPPPPDYGPHADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNF 440          
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: HNRPL_HUMAN (Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens GN=HNRNPL PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 2.395e-24
Identity = 82/295 (27.80%), Postives = 137/295 (46.44%), Query Frame = 2
Query:    2 NALQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNL-----------------------PAEQKGRPS--QSGYSEAGVAFPQMXXXXXXXXXFGGG-------------------LPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLLRNKPDHALXQMGDGXQAELAXHFLKGXY 754
            NA+ +  + Q  I G   +V +S+ Q+++    +   R    N +LL TI + +Y IT +VL+ + +P G V++IV F+K+ G QA++++    SA  A++SL G +IY GCC L I+++    L V  N++ + D+TNPNL                       PAE  G      S Y + G   P             GG                    PP      D   ++V  L+  +++ D++FN+  LYGN+ ++K +++KP  A+ +M DG   + A   L   +
Sbjct:  152 NAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRS--VNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKN-GVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGHRRGPSRYGPQYGHPPPPPPPPEYGPHADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNF 443          
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: HNRLL_HUMAN (Heterogeneous nuclear ribonucleoprotein L-like OS=Homo sapiens GN=HNRPLL PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 4.085e-24
Identity = 78/257 (30.35%), Postives = 127/257 (49.42%), Query Frame = 2
Query:   38 IRGRNVYVQFSSHQELTTMEQNAQGRGDEP---NRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPSQ--------------SGYSEAGVAFP----QMXXXXXXXXXFGGGLPPGIT-----GTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLLRNKPDHALXQMGDGXQAELA 730
            I G+  +  +S+ + +T       G  D+P   N++LL++I + LYPITV+VL+ V +P G V++IV F+++ G QA+++++    A  A+++L G +IY GCC L I+++    L V  N+  S D+T P L    +G+  Q               GY   G   P                   LP   +     G      V+VS L+  +++  ++FNL  LYGNI ++K ++  P  AL +MGD    E A
Sbjct:  138 IAGQQAFFNYSTSKRITR-----PGNTDDPSGGNKVLLLSIQNPLYPITVDVLYTVCNPVGKVQRIVIFKRN-GIQAMVEFESVLCAQKAKAALNGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYTKPYLGRRDRGKGRQRQAILGEHPSSFRHDGYGSHGPLLPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCSRVFNLFCLYGNIEKVKFMKTIPGTALVEMGDEYAVERA 388          
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: PTBP2_ARATH (Polypyrimidine tract-binding protein homolog 2 OS=Arabidopsis thaliana GN=At5g53180 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.453e-21
Identity = 55/122 (45.08%), Postives = 79/122 (64.75%), Query Frame = 2
Query:  110 GRGDEP-NRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYD-GCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPSQSGYS 469
            G+  EP + +LL +I +M Y +T++VLH VF+  G V+KI  F K+ G QALIQY    +AVVA+ +L+G  IYD G C+L I +S   +L +  NN+RSRD+T PN P     +P Q+ Y+
Sbjct:  236 GKKMEPESNVLLASIENMQYAVTLDVLHMVFAAFGEVQKIAMFDKNGGVQALIQYSDVQTAVVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKVNNDRSRDYTMPNPPVPMPQQPVQNPYA 357          

HSP 2 Score: 98.2117 bits (243), Expect = 6.104e-20
Identity = 57/139 (41.01%), Postives = 83/139 (59.71%), Query Frame = 2
Query:   38 IRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIH-HMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNI-------YDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLP 430
            +RG+ VY+Q+S+ QE+   +  A    D    +LLVTI       ++++VLH VFS  GFV KI TF+K+AG+QAL+Q+    +A  A+ +L GR+I         G C L I +S   +L V + + RSRD+TNP LP
Sbjct:   84 VRGKTVYLQYSNRQEIVNNKTTA----DVVGNVLLVTIEGDDARMVSIDVLHLVFSAFGFVHKITTFEKTAGYQALVQFTDAETATAAKLALDGRSIPRYLLAETVGQCSLKITYSAHTDLTVKFQSHRSRDYTNPYLP 218          
The following BLAST results are available for this feature:
BLAST of DC900346 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
ROD1_RAT7.667e-3934.84Regulator of differentiation 1 OS=Rattus norvegicu... [more]
ROD1_HUMAN2.914e-3834.52Regulator of differentiation 1 OS=Homo sapiens GN=... [more]
PTBP1_ARATH1.075e-2432.11Polypyrimidine tract-binding protein homolog 1 OS=... [more]
HNRLL_MOUSE1.075e-2430.19Heterogeneous nuclear ribonucleoprotein L-like OS=... [more]
HNRPL_MOUSE1.833e-2427.80Heterogeneous nuclear ribonucleoprotein L OS=Mus m... [more]
HNRPL_HUMAN2.395e-2427.80Heterogeneous nuclear ribonucleoprotein L OS=Homo ... [more]
HNRLL_HUMAN4.085e-2430.35Heterogeneous nuclear ribonucleoprotein L-like OS=... [more]
PTBP2_ARATH1.453e-2145.08Polypyrimidine tract-binding protein homolog 2 OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900346 VSS Citrus sinensis cDNA clone VS28904 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900346 ID=DC900346|Name=DC900346|organism=Citrus sinensis|type=EST|length=848bp
CAATGCTCTGCAATTTTACACGAATGTGCAGCCAACCATCAGGGGAAGGA
ATGTTTATGTCCAATTTTCATCACATCAGGAACTAACAACAATGGAACAG
AATGCTCAAGGACGAGGTGATGAGCCGAACCGAATTCTCTTAGTTACAAT
TCATCACATGCTTTATCCTATTACTGTGGAAGTGCTGCATCAAGTTTTTT
CTCCTCATGGATTTGTGGAAAAGATCGTCACATTCCAGAAGTCAGCTGGA
TTTCAAGCACTTATCCAGTATCAATTACGTCCGAGTGCTGTTGTAGCTAG
AAGTTCTCTTCAGGGTCGTAATATTTATGATGGTTGCTGTCAGCTGGACA
TTCAATTCTCAAACCTTGATGAGTTACAAGTGAACTACAATAATGAGCGA
TCAAGGGACTTCACAAATCCAAATCTTCCTGCAGAACAGAAAGGCAGACC
CTCACAATCTGGGTACAGCGAAGCAGGAGTTGCATTTCCACAGATGGCCA
ATGCAGCTGCAATTGCAGCCGCCTTTGGCGGAGGTCTACCTCCTGGAATA
ACAGGGACAAATGATAGGTGTACAGTCTTAGTTTCCAATCTCAATTCTGA
TAGAATAGATGAGGATAAGCTTTTTAACTTGNTCTCCCTCTATGGAAATA
TCATAAGAATCAAACTCCTCCGCAATAAACCAGATCATGCTCTTGNTCAG
ATGGGCGATGGCTTNCAGGCTGAATTGGCGGNGCACTTTCTGAAGGGGNC
TTACTNTTGGGAAGCGATTAGAGGTCACTTNTTTAGCATCCCATATACCT
CAGGNGCTGCCCCATGATCATGACTCGACCTTACCGTTTAACGTATGC
back to top