DC900342

Overview
NameDC900342
Unique NameDC900342
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1211
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12689 contig Csv1_Contig12689:61..1271. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB2_SYNE7 (Chaperone protein clpB 2 OS=Synechococcus elongatus (strain PCC 7942) GN=clpB2 PE=3 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 8.259e-94
Identity = 164/274 (59.85%), Postives = 218/274 (79.56%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            V+GQD AV +VA AI+R+RAG+ DP RPI SF+F+GPTGVGKTELA+ALA+ +F+ E+AL+R DMSEYMEK+++SRLIGAPPGY+GYEEGGQL+E +RR PYAV+LFDE+EKAH DVFN+ LQ+LDDGR+TDSQGRT+ F N VI+MTSN+GSQ+IL M +E    E + + ++ +V+ A R  FRPEF+NR+D+ I+FQPL R Q+  IV +QL R+++ +A++ + + VT AA   L   GYDP YGARP+KR IQ+ +EN +A  IL  +F
Sbjct:  582 VIGQDEAVVAVAAAIRRARAGMKDPSRPIGSFLFLGPTGVGKTELARALANCLFDAEDALIRFDMSEYMEKNSISRLIGAPPGYIGYEEGGQLSEAIRRHPYAVVLFDEVEKAHPDVFNLLLQVLDDGRITDSQGRTIDFCNAVIVMTSNIGSQFILEMGEE----EASLDAVELKVLGALRQHFRPEFLNRIDDTILFQPLSRGQLQQIVDIQLQRLKRLLAEQAIALNVTPAAAANLADRGYDPVYGARPLKRAIQRLIENPVASLILEQQF 851          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_VIBVY (Chaperone protein clpB OS=Vibrio vulnificus (strain YJ016) GN=clpB PE=3 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 1.079e-93
Identity = 168/272 (61.76%), Postives = 216/272 (79.41%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRG 876
            V+GQ  AV+ VA AI+RSRAGLSDP++PI SF+F+GPTGVGKTEL K LA++MF++E+A+VRIDMSE+MEKH+V+RL+GAPPGYVGYEEGG LTE VRR+PY+VIL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTV+IMTSN+GS  I     E F     Y+ IK++VM+     FRPEF+NRVDE +VF PL +D I SI  +QL+R+  R+ +   +++V+D A++L+  +G+DP YGARP+KR IQQ +EN LAK IL G
Sbjct:  570 VIGQKEAVEVVANAIRRSRAGLSDPNKPIGSFLFLGPTGVGKTELCKTLANFMFDSEDAMVRIDMSEFMEKHSVARLVGAPPGYVGYEEGGYLTEAVRRKPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSSRI----QENFAM-LDYQGIKEQVMEVVTKHFRPEFLNRVDETVVFHPLSQDHIKSIAAIQLNRLANRMEEHGYQLEVSDKALELIAQVGFDPVYGARPLKRAIQQSIENPLAKSILAG 836          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_SHIFL (Chaperone protein clpB OS=Shigella flexneri GN=clpB PE=3 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 1.409e-93
Identity = 170/273 (62.27%), Postives = 216/273 (79.12%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQ+ AV +V+ AI+RSRAGL+DP+RPI SF+F+GPTGVGKTEL KALA++MF+++EA+VRIDMSE+MEKH+VSRL+GAPPGYVGYEEGG LTE VRRRPY+VIL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTV+IMTSN+GS  I     E F  E  Y  +K+ V+      FRPEF+NR+DE +VF PL    I+SI ++QL R+ KR+ +R  ++ ++D A++LL   GYDP YGARP+KR IQQ +EN LA+ IL GE
Sbjct:  570 VIGQNEAVDAVSNAIRRSRAGLADPNRPIGSFLFLGPTGVGKTELCKALANFMFDSDEAMVRIDMSEFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSDLI----QERF-GELDYAHMKELVLGVVSHNFRPEFINRIDEVVVFHPLGEQHIASIAQIQLKRLYKRLEERGYEIHISDEALKLLSENGYDPVYGARPLKRAIQQQIENPLAQQILSGE 837          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_ECOLI (Chaperone protein clpB OS=Escherichia coli (strain K12) GN=clpB PE=1 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 1.409e-93
Identity = 170/273 (62.27%), Postives = 216/273 (79.12%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQ+ AV +V+ AI+RSRAGL+DP+RPI SF+F+GPTGVGKTEL KALA++MF+++EA+VRIDMSE+MEKH+VSRL+GAPPGYVGYEEGG LTE VRRRPY+VIL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTV+IMTSN+GS  I     E F  E  Y  +K+ V+      FRPEF+NR+DE +VF PL    I+SI ++QL R+ KR+ +R  ++ ++D A++LL   GYDP YGARP+KR IQQ +EN LA+ IL GE
Sbjct:  570 VIGQNEAVDAVSNAIRRSRAGLADPNRPIGSFLFLGPTGVGKTELCKALANFMFDSDEAMVRIDMSEFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSDLI----QERF-GELDYAHMKELVLGVVSHNFRPEFINRIDEVVVFHPLGEQHIASIAQIQLKRLYKRLEERGYEIHISDEALKLLSENGYDPVYGARPLKRAIQQQIENPLAQQILSGE 837          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_ECOL6 (Chaperone protein clpB OS=Escherichia coli O6 GN=clpB PE=3 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 1.409e-93
Identity = 170/273 (62.27%), Postives = 216/273 (79.12%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQ+ AV +V+ AI+RSRAGL+DP+RPI SF+F+GPTGVGKTEL KALA++MF+++EA+VRIDMSE+MEKH+VSRL+GAPPGYVGYEEGG LTE VRRRPY+VIL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTV+IMTSN+GS  I     E F  E  Y  +K+ V+      FRPEF+NR+DE +VF PL    I+SI ++QL R+ KR+ +R  ++ ++D A++LL   GYDP YGARP+KR IQQ +EN LA+ IL GE
Sbjct:  570 VIGQNEAVDAVSNAIRRSRAGLADPNRPIGSFLFLGPTGVGKTELCKALANFMFDSDEAMVRIDMSEFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSDLI----QERF-GELDYAHMKELVLGVVSHNFRPEFINRIDEVVVFHPLGEQHIASIAQIQLKRLYKRLEERGYEIHISDEALKLLSENGYDPVYGARPLKRAIQQQIENPLAQQILSGE 837          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_ECO57 (Chaperone protein clpB OS=Escherichia coli O157:H7 GN=clpB PE=3 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 1.409e-93
Identity = 170/273 (62.27%), Postives = 216/273 (79.12%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQ+ AV +V+ AI+RSRAGL+DP+RPI SF+F+GPTGVGKTEL KALA++MF+++EA+VRIDMSE+MEKH+VSRL+GAPPGYVGYEEGG LTE VRRRPY+VIL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTV+IMTSN+GS  I     E F  E  Y  +K+ V+      FRPEF+NR+DE +VF PL    I+SI ++QL R+ KR+ +R  ++ ++D A++LL   GYDP YGARP+KR IQQ +EN LA+ IL GE
Sbjct:  570 VIGQNEAVDAVSNAIRRSRAGLADPNRPIGSFLFLGPTGVGKTELCKALANFMFDSDEAMVRIDMSEFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSDLI----QERF-GELDYAHMKELVLGVVSHNFRPEFINRIDEVVVFHPLGEQHIASIAQIQLKRLYKRLEERGYEIHISDEALKLLSENGYDPVYGARPLKRAIQQQIENPLAQQILSGE 837          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_RHIME (Chaperone protein clpB OS=Rhizobium meliloti GN=clpB PE=3 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 1.840e-93
Identity = 167/274 (60.95%), Postives = 218/274 (79.56%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQ  AV++V+ A++RSRAGL DP+RPI SF+F+GPTGVGKTEL KALA ++F+ E AL+RIDMSEYMEKH+V+RLIGAPPGYVGYEEGG LTE VRRRPY V+LFDEIEKAH DVFNV LQ+LDDGR+TD QGRTV F NT+IIMTSN+G++Y+  + +         + ++ +VM+  R  FRPEF+NRVDE I+F  L R ++ +IV +QL+R++K ++DRK+ +++ D A   L   GYDP YGARP+KR IQ+YV++ LA+ +L+GEF
Sbjct:  572 VVGQGDAVQAVSRAVRRSRAGLQDPNRPIGSFIFLGPTGVGKTELTKALARFLFDDETALMRIDMSEYMEKHSVARLIGAPPGYVGYEEGGALTESVRRRPYQVVLFDEIEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFKNTMIIMTSNLGAEYLTALGE-----NEDSDAVRDQVMEVVRAAFRPEFLNRVDEIILFHRLRRSEMGAIVDIQLERLRKLLSDRKITLELEDDARVFLADRGYDPAYGARPLKRAIQKYVQDPLAEKVLQGEF 840          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_VIBVU (Chaperone protein clpB OS=Vibrio vulnificus GN=clpB PE=3 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 2.403e-93
Identity = 168/272 (61.76%), Postives = 215/272 (79.04%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRG 876
            V+GQ  AV+ VA AI+RSRAGLSDP++PI SF+F+GPTGVGKTEL K LA++MF++E+A+VRIDMSE+MEKH+V+RL+GAPPGYVGYEEGG LTE VRR+PY+VIL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTV+IMTSN+GS  I     E F     Y+ IK++VM+     FRPEF+NRVDE +VF PL +D I SI  +QL+R+  R+ +    ++V+D A++L+  +G+DP YGARP+KR IQQ +EN LAK IL G
Sbjct:  570 VIGQKEAVEVVANAIRRSRAGLSDPNKPIGSFLFLGPTGVGKTELCKTLANFMFDSEDAMVRIDMSEFMEKHSVARLVGAPPGYVGYEEGGYLTEAVRRKPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSSRI----QENFAM-LDYQGIKEQVMEVVTKHFRPEFLNRVDETVVFHPLGQDHIKSIAAIQLNRLANRMEEHGYPLEVSDKALELIAQVGFDPVYGARPLKRAIQQSIENPLAKSILAG 836          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_NEIMA (Chaperone protein clpB OS=Neisseria meningitidis serogroup A GN=clpB PE=3 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 3.139e-93
Identity = 163/274 (59.49%), Postives = 217/274 (79.20%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQD AV++V++AI+RSR+GL+DP++P  SF+F+GPTGVGKTEL KALA ++F++E+ L+RIDMSEYMEKHAV+RLIGAPPGYVGYEEGG LTE VRR+PY+VIL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTVI+MTSN+GSQ+I  M  +       YE +K+ VM+  +  FRPE +NR+DE +VF  LD+  I SI ++QL  ++KR+  + +++ V+DAA+ ++   G+DP YGARP+KR IQ  +EN LAK +L G +
Sbjct:  574 VVGQDEAVRAVSDAIRRSRSGLADPNKPYGSFLFLGPTGVGKTELCKALAGFLFDSEDHLIRIDMSEYMEKHAVARLIGAPPGYVGYEEGGYLTEQVRRKPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFKNTVIVMTSNIGSQHIQQMGIQD------YEAVKEVVMEDVKEHFRPEMINRIDEVVVFHGLDQANIRSIAKIQLKGLEKRLEKQNLRLAVSDAALDIIAKAGFDPIYGARPLKRAIQSEIENPLAKALLAGNY 841          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_BRUSU (Chaperone protein clpB OS=Brucella suis GN=clpB PE=2 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 3.139e-93
Identity = 169/273 (61.90%), Postives = 218/273 (79.85%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            VVGQ  AV+++++A++R+RAGL DP+RPI SF+F+GPTGVGKTEL KALAS++F  + A+VRIDMSE+MEKH+VSRLIGAPPGYVGYEEGG LTE VRRRPY VILFDEIEKAH DVFNV LQ+LDDGR+TD QGRTV F NTVIIMTSN+G++Y++N+ +         ET++  VM   R  FRPEF+NRVDE I+F  L R+ + +IV +Q+ R+Q  ++DRK+ +Q+ D A + L + GYDP YGARP+KRVIQ+ V++ LA+ IL G+
Sbjct:  570 VVGQGEAVQAISKAVRRARAGLQDPNRPIGSFIFLGPTGVGKTELTKALASFLFQDDTAMVRIDMSEFMEKHSVSRLIGAPPGYVGYEEGGVLTEAVRRRPYQVILFDEIEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFRNTVIIMTSNLGAEYLVNLGE-----NDDVETVRDDVMGVVRASFRPEFLNRVDEIILFHRLRREDMGAIVDIQMQRLQYLLSDRKITLQLEDDAREWLANKGYDPAYGARPLKRVIQKEVQDPLAERILLGD 837          
The following BLAST results are available for this feature:
BLAST of DC900342 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 200
Match NameE-valueIdentityDescription
CLPB2_SYNE78.259e-9459.85Chaperone protein clpB 2 OS=Synechococcus elongatu... [more]
CLPB_VIBVY1.079e-9361.76Chaperone protein clpB OS=Vibrio vulnificus (strai... [more]
CLPB_SHIFL1.409e-9362.27Chaperone protein clpB OS=Shigella flexneri GN=clp... [more]
CLPB_ECOLI1.409e-9362.27Chaperone protein clpB OS=Escherichia coli (strain... [more]
CLPB_ECOL61.409e-9362.27Chaperone protein clpB OS=Escherichia coli O6 GN=c... [more]
CLPB_ECO571.409e-9362.27Chaperone protein clpB OS=Escherichia coli O157:H7... [more]
CLPB_RHIME1.840e-9360.95Chaperone protein clpB OS=Rhizobium meliloti GN=cl... [more]
CLPB_VIBVU2.403e-9361.76Chaperone protein clpB OS=Vibrio vulnificus GN=clp... [more]
CLPB_NEIMA3.139e-9359.49Chaperone protein clpB OS=Neisseria meningitidis s... [more]
CLPB_BRUSU3.139e-9361.90Chaperone protein clpB OS=Brucella suis GN=clpB PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900342 VSS Citrus sinensis cDNA clone VS28693 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900342 ID=DC900342|Name=DC900342|organism=Citrus sinensis|type=EST|length=1211bp
AAGCTTCAACAATCAGAGAGGGAGAAGCTGTTACATTTGGAGGAAGAGCT
GCACAAACGTGTTGTGGGTCAAGATCCAGCAGTGAAATCAGTAGCTGAGG
CGATTCAGCGATCTCGAGCAGGTCTTTCTGATCCTCACCGTCCAATAGCT
AGTTTCATGTTCATGGGTCCAACTGGTGTTGGAAAGACTGAACTGGCTAA
GGCACTAGCTTCCTACATGTTCAACACTGAAGAGGCCCTTGTACGAATTG
ATATGAGTGAGTATATGGAAAAGCATGCTGTTTCAAGATTGATTGGAGCC
CCACCTGGTTATGTGGGATATGAGGAAGGAGGACAGTTGACGGAGGTAGT
TCGCCGTAGGCCCTATGCAGTAATTCTGTTCGACGAGATTGAGAAGGCCC
ACTCTGATGTATTTAATGTGTTTCTTCAAATTCTGGATGATGGGAGAGTT
ACTGATTCACAGGGTCGTACTGTGAGTTTCACCAATACTGTCATCATTAT
GACTTCAAACGTGGGTTCACAATACATACTTAATATGGATGATGAGACAT
TCCCGAAGGAGACAGCCTATGAAACTATCAAACAGCGGGTAATGGATGCT
GCAAGATTAATATTCCGCCCCGAGTTCATGAACCGAGTAGATGAGTATAT
AGTATTCCAACCACTGGACCGTGACCAGATAAGCAGTATTGTGAGGTTAC
AGTTGGATCGGGTGCAGAAGAGGATTGCAGACCGGAAGATGAAAATGCAA
GTGACCGATGCAGCTATTCAGCTCCTTGGGAGTCTTGGGTATGACCCCAA
CTATGGTGCAAGGCCGGTCAAGAGGGTGATTCAGCAGTACGTTGAAAATG
AGCTTGCCAAGGGCATTCTGAGAGGGGAGTTCAAGGATGATGACACAATT
GTAACAGACACTGAAGTTACAGCATTTTCCAATGGCCAGCTTCCGCAGCA
AAAGCTAGTCTTCAGGAGACTTGATACCAGTTCGGATGCTTCTGCTGCAG
ATAACCAAGAAGCTTTCTCACAGACAGCATAAATGTCTGTCCAATGTGTT
TAATTTTACGAAATTATATTTGTGTTCAGCAAAATTATGAGCGAATTTTC
TTAACTGATAGGCTGTAACCTGCTTCTTGTATATGATGATGCTTTATACA
AAATCATAAGCCTTGAAGTGTTTCTTTTTCAACGATCATCACAAATTCAC
ATTCGTTTTAT
back to top