DC900342

Overview
NameDC900342
Unique NameDC900342
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1211
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12689 contig Csv1_Contig12689:61..1271. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_BRAJA (Chaperone protein clpB OS=Bradyrhizobium japonicum GN=clpB PE=3 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 4.099e-93
Identity = 174/297 (58.59%), Postives = 220/297 (74.07%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFKXXXXXXXXXXXXAFS-NGQLPQ 948
            VVGQ  AV +VA A++RSRAGL DP+RP+ SFMF+GPTGVGKTEL KALA Y+FN E A+VR+DMSEYMEKH+VSRLIGAPPGYVGY+EGG LTE VRRRPY V+LFDEIEKAH DVFNV LQ+LDDGR+TD QGRTV F NT+IIMTSN+GS++++N      P+      ++++VM   R  FRPEF+NRVDE I+F  L R ++  IV +Q  R+QK + DRK+ + +  AA   L + G+DP YGARP+KRVIQ+Y+++ LA+ IL G+ K              + NG+ PQ
Sbjct:  571 VVGQAEAVHAVATAVRRSRAGLQDPNRPMGSFMFLGPTGVGKTELTKALAEYLFNDETAMVRLDMSEYMEKHSVSRLIGAPPGYVGYDEGGALTEAVRRRPYQVVLFDEIEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFRNTLIIMTSNLGSEFLVNQ-----PEGEDTSAVREQVMGMVRGHFRPEFLNRVDEIILFHRLQRSEMGRIVEIQFARLQKLLTDRKIVLTLDGAARDWLAAKGWDPAYGARPLKRVIQRYLQDPLAEMILAGDVKDGDNVAISSEGNVLTFNGKAPQ 862          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_SHEON (Chaperone protein clpB OS=Shewanella oneidensis GN=clpB PE=3 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 5.354e-93
Identity = 166/273 (60.81%), Postives = 215/273 (78.75%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQ+ AV +VA AI+RSRAGL+DP+RPI SF+F+GPTGVGKTEL K+LA ++F++E ALVRIDMSE+MEKHAVSRL+GAPPGYVGYEEGG LTE VRR+PY+VIL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTVIIMTSN+GS  I     E F    +Y  +K  VM+     FRPEF+NR+DE +VF PLD + I  I  +Q+  ++KR+A++   +++TD A+ L+  +G+DP YGARP+KR +QQ +EN LA+ +LRG+
Sbjct:  570 VIGQNEAVDAVANAIRRSRAGLADPNRPIGSFLFLGPTGVGKTELCKSLARFLFDSESALVRIDMSEFMEKHAVSRLVGAPPGYVGYEEGGYLTEAVRRKPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVIIMTSNLGSDII----QEGF-GHLSYSEMKSAVMNVVTHSFRPEFLNRIDESVVFHPLDAENIKHIASIQIASLRKRLAEKDYTLEITDEALSLIAEIGFDPVYGARPLKRALQQEMENPLAQKLLRGD 837          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_PSEAE (Chaperone protein clpB OS=Pseudomonas aeruginosa GN=clpB PE=3 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 6.992e-93
Identity = 162/274 (59.12%), Postives = 220/274 (80.29%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            V+GQD AV +V+ A++RSRAGL+DP+RP  SF+F+GPTGVGKTEL KALA ++F+TEEALVRIDMSE+MEKH+V+RLIGAPPGYVG+EEGG LTE +RR+PY+V+L DE+EKAH DVFN+ LQ+L+DGR+TDS GRTV F NTV++MTSN+GS  I  +  +        E  +  VMDA    FRPEF+NR+DE +VF+PL R+QI+ I  +QL R++KR+A+R++ ++++  A+  L ++G+DP YGARP+KR IQ+++EN LA+ IL G+F
Sbjct:  570 VIGQDEAVVAVSNAVRRSRAGLADPNRPSGSFLFLGPTGVGKTELCKALAEFLFDTEEALVRIDMSEFMEKHSVARLIGAPPGYVGFEEGGYLTEAIRRKPYSVVLLDEVEKAHPDVFNILLQVLEDGRLTDSHGRTVDFRNTVVVMTSNLGSAQIQELAGDR-------EAQRAAVMDAVNAHFRPEFINRIDEVVVFEPLAREQIAGIAEIQLGRLRKRLAERELSLELSQEALDKLIAVGFDPVYGARPLKRAIQRWIENPLAQLILAGKF 836          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_BORPE (Chaperone protein clpB OS=Bordetella pertussis GN=clpB PE=3 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 6.992e-93
Identity = 167/274 (60.95%), Postives = 216/274 (78.83%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQD AV+ V++AI+RSRAGL+DP RP  SF+F+GPTGVGKTEL +ALA ++F++EE ++RIDMSE+MEKH+V+RLIGAPPGYVGYEEGG LTE VRR+PY+VIL DE+EKAH DVFNV LQ+LDDGR+TD QGRTV F NTVI+MTSN+GSQ+I +M  +       YE IK+ V D  +  FRPEF+NR+DE +VF  L+   I SI R+QL R+ +R+  ++M++ V+DAA+  +   G+DP +GARP+KR IQQ +EN +AK IL G F
Sbjct:  576 VVGQDEAVRLVSDAIRRSRAGLADPSRPYGSFLFLGPTGVGKTELTRALADFLFDSEEHMIRIDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEAVRRKPYSVILLDEVEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFRNTVIVMTSNLGSQHIQSMAGK------PYEVIKEVVWDELKHTFRPEFLNRIDEVVVFHGLEAQHIESIARIQLKRLGERLEKQEMRLDVSDAALAEIARSGFDPVFGARPLKRAIQQQIENPVAKLILEGVF 843          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_BORBR (Chaperone protein clpB OS=Bordetella bronchiseptica GN=clpB PE=3 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 6.992e-93
Identity = 167/274 (60.95%), Postives = 216/274 (78.83%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQD AV+ V++AI+RSRAGL+DP RP  SF+F+GPTGVGKTEL +ALA ++F++EE ++RIDMSE+MEKH+V+RLIGAPPGYVGYEEGG LTE VRR+PY+VIL DE+EKAH DVFNV LQ+LDDGR+TD QGRTV F NTVI+MTSN+GSQ+I +M  +       YE IK+ V D  +  FRPEF+NR+DE +VF  L+   I SI R+QL R+ +R+  ++M++ V+DAA+  +   G+DP +GARP+KR IQQ +EN +AK IL G F
Sbjct:  576 VVGQDEAVRLVSDAIRRSRAGLADPSRPYGSFLFLGPTGVGKTELTRALADFLFDSEEHMIRIDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEAVRRKPYSVILLDEVEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFRNTVIVMTSNLGSQHIQSMAGK------PYEVIKEVVWDELKHTFRPEFLNRIDEVVVFHGLEAQHIESIARIQLKRLGERLEKQEMRLDVSDAALAEIARSGFDPVFGARPLKRAIQQQIENPVAKLILEGVF 843          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_PHOLL (Chaperone protein clpB OS=Photorhabdus luminescens subsp. laumondii GN=clpB PE=3 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 9.132e-93
Identity = 167/273 (61.17%), Postives = 216/273 (79.12%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQD AV +++ AI+RSRAGL+DP+RPI SF+F+GPTGVGKTEL KALA+++F++++A+VRIDMSE+MEKHAVSRL+GAPPGYVGYEEGG LTE VRRRPY+VIL DE+EKAHSDVFN+ LQ+LDDGR+TD QGRTV F NTV+IMTSN+GS    +M  E F     Y+ +K  VM      FRPEF+NR+DE +VF PL R  +S+I  +QL R+ KR+ +R  ++ +T  A+++L   G+DP YGARP+KR IQQ +EN LA+ IL G+
Sbjct:  570 VIGQDEAVNAISNAIRRSRAGLADPNRPIGSFLFLGPTGVGKTELCKALANFLFDSDDAMVRIDMSEFMEKHAVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHSDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGS----DMIQERF-GSLNYDEMKDIVMGIVSHNFRPEFINRIDEAVVFHPLGRRHLSAIADIQLQRLYKRLEERGYQVTITQQALEILAEAGFDPVYGARPLKRAIQQEIENPLAQKILSGQ 837          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_CHRVO (Chaperone protein clpB OS=Chromobacterium violaceum GN=clpB PE=3 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 9.132e-93
Identity = 167/274 (60.95%), Postives = 213/274 (77.74%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQD AV +VA+AI+RSR+GL+DP++P  SF+F+GPTGVGKTEL K LAS++F++++ L+RIDMSEYMEKH+V+RLIGAPPGYVGYEEGG LTE VRR+PY+VIL DE+EKAH DVFNV LQ+LDDGR+TD QGRTV F NTVI+MTSN+GSQ I  M  +       Y+ IK  VM   +  FRPEF+NR+DE +VF  LD   I SI R+QL  ++ R+A  ++ +Q++D A+ LL   G+DP YGARP+KR IQ  +EN LAK IL G++
Sbjct:  574 VVGQDEAVSAVADAIRRSRSGLADPNKPYGSFLFLGPTGVGKTELCKTLASFLFDSKDHLIRIDMSEYMEKHSVARLIGAPPGYVGYEEGGYLTEQVRRKPYSVILLDEVEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFKNTVIVMTSNIGSQQIQAMATDD------YQVIKLAVMAEVKTQFRPEFINRIDEVVVFHGLDEKHIQSIARIQLKSLENRLAKLELSLQISDEALALLSEAGFDPVYGARPLKRAIQAELENPLAKAILAGKY 841          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_BORPA (Chaperone protein clpB OS=Bordetella parapertussis GN=clpB PE=3 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 9.132e-93
Identity = 166/274 (60.58%), Postives = 216/274 (78.83%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQD AV+ V++AI+RSRAGL+DP RP  SF+F+GPTGVGKTEL +ALA ++F++EE ++RIDMSE+MEKH+V+RLIGAPPGYVGYEEGG LTE VRR+PY+VIL DE+EKAH DVFNV LQ+LDDGR+TD QGRTV F NTVI+MTSN+GSQ+I +M  +       YE IK+ V D  +  FRPEF+NR+DE +VF  L+   I SI R+QL R+ +R+  ++M++ V+DAA+  +   G+DP +GARP+KR +QQ +EN +AK IL G F
Sbjct:  576 VVGQDEAVRLVSDAIRRSRAGLADPSRPYGSFLFLGPTGVGKTELTRALADFLFDSEEHMIRIDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEAVRRKPYSVILLDEVEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFRNTVIVMTSNLGSQHIQSMAGK------PYEVIKEVVWDELKHTFRPEFLNRIDEVVVFHGLEAQHIESIARIQLKRLGERLEKQEMRLDVSDAALAEIARSGFDPVFGARPLKRAVQQQIENPVAKLILEGVF 843          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_BRUME (Chaperone protein clpB OS=Brucella melitensis GN=clpB PE=3 SV=2)

HSP 1 Score: 340.502 bits (872), Expect = 1.193e-92
Identity = 168/273 (61.54%), Postives = 217/273 (79.49%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            VVGQ  AV+++++A++R+RAGL DP+RPI SF+F+GPTGVGKTEL KALAS++F  + A+VRIDMSE+MEKH+VSRLIGAPPGYVGYEEGG LTE VRRRPY VILFDEIEKAH DVFNV LQ+LDDGR+TD QG TV F NTVIIMTSN+G++Y++N+ +         ET++  VM   R  FRPEF+NRVDE I+F  L R+ + +IV +Q+ R+Q  ++DRK+ +Q+ D A + L + GYDP YGARP+KRVIQ+ V++ LA+ IL G+
Sbjct:  570 VVGQGEAVQAISKAVRRARAGLQDPNRPIGSFIFLGPTGVGKTELTKALASFLFQDDTAMVRIDMSEFMEKHSVSRLIGAPPGYVGYEEGGVLTEAVRRRPYQVILFDEIEKAHPDVFNVLLQVLDDGRLTDGQGHTVDFRNTVIIMTSNLGAEYLVNLGE-----NDDVETVRDDVMGVVRASFRPEFLNRVDEIILFHRLRREDMGAIVDIQMQRLQYLLSDRKITLQLEDDAREWLANKGYDPAYGARPLKRVIQKEVQDPLAERILLGD 837          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_PSEPK (Chaperone protein clpB OS=Pseudomonas putida (strain KT2440) GN=clpB PE=3 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 2.657e-92
Identity = 165/274 (60.22%), Postives = 216/274 (78.83%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            V+GQ  AV +VA A++RSRAGLSDP+RP  SF+F+GPTGVGKTEL KALA ++F+TEEA+VRIDMSE+MEKH+V+RLIGAPPGYVGYEEGG LTE VRR+PY+V+L DE+EKAH DVFNV LQ+L+DGR+TDS GRTV F NTVI+MTSN+GS  I  +  +        E  +  VMDA    FRPEF+NR+DE +VF+PL R+QI+ I  +QL R++ R+ +R++ + ++  A+  L ++GYDP YGARP+KR IQ+++EN LA+ IL G+F
Sbjct:  570 VIGQSEAVTAVANAVRRSRAGLSDPNRPSGSFLFLGPTGVGKTELCKALAEFLFDTEEAMVRIDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEAVRRKPYSVVLLDEVEKAHPDVFNVLLQVLEDGRLTDSHGRTVDFRNTVIVMTSNLGSAQIQELVGDR-------EAQRAAVMDAVGAHFRPEFINRIDEVVVFEPLGREQIAGITEIQLGRLRSRLLERELSLSLSPEALDKLIAVGYDPVYGARPLKRAIQRWIENPLAQLILAGKF 836          
The following BLAST results are available for this feature:
BLAST of DC900342 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 200
Match NameE-valueIdentityDescription
CLPB_BRAJA4.099e-9358.59Chaperone protein clpB OS=Bradyrhizobium japonicum... [more]
CLPB_SHEON5.354e-9360.81Chaperone protein clpB OS=Shewanella oneidensis GN... [more]
CLPB_PSEAE6.992e-9359.12Chaperone protein clpB OS=Pseudomonas aeruginosa G... [more]
CLPB_BORPE6.992e-9360.95Chaperone protein clpB OS=Bordetella pertussis GN=... [more]
CLPB_BORBR6.992e-9360.95Chaperone protein clpB OS=Bordetella bronchiseptic... [more]
CLPB_PHOLL9.132e-9361.17Chaperone protein clpB OS=Photorhabdus luminescens... [more]
CLPB_CHRVO9.132e-9360.95Chaperone protein clpB OS=Chromobacterium violaceu... [more]
CLPB_BORPA9.132e-9360.58Chaperone protein clpB OS=Bordetella parapertussis... [more]
CLPB_BRUME1.193e-9261.54Chaperone protein clpB OS=Brucella melitensis GN=c... [more]
CLPB_PSEPK2.657e-9260.22Chaperone protein clpB OS=Pseudomonas putida (stra... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900342 VSS Citrus sinensis cDNA clone VS28693 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900342 ID=DC900342|Name=DC900342|organism=Citrus sinensis|type=EST|length=1211bp
AAGCTTCAACAATCAGAGAGGGAGAAGCTGTTACATTTGGAGGAAGAGCT
GCACAAACGTGTTGTGGGTCAAGATCCAGCAGTGAAATCAGTAGCTGAGG
CGATTCAGCGATCTCGAGCAGGTCTTTCTGATCCTCACCGTCCAATAGCT
AGTTTCATGTTCATGGGTCCAACTGGTGTTGGAAAGACTGAACTGGCTAA
GGCACTAGCTTCCTACATGTTCAACACTGAAGAGGCCCTTGTACGAATTG
ATATGAGTGAGTATATGGAAAAGCATGCTGTTTCAAGATTGATTGGAGCC
CCACCTGGTTATGTGGGATATGAGGAAGGAGGACAGTTGACGGAGGTAGT
TCGCCGTAGGCCCTATGCAGTAATTCTGTTCGACGAGATTGAGAAGGCCC
ACTCTGATGTATTTAATGTGTTTCTTCAAATTCTGGATGATGGGAGAGTT
ACTGATTCACAGGGTCGTACTGTGAGTTTCACCAATACTGTCATCATTAT
GACTTCAAACGTGGGTTCACAATACATACTTAATATGGATGATGAGACAT
TCCCGAAGGAGACAGCCTATGAAACTATCAAACAGCGGGTAATGGATGCT
GCAAGATTAATATTCCGCCCCGAGTTCATGAACCGAGTAGATGAGTATAT
AGTATTCCAACCACTGGACCGTGACCAGATAAGCAGTATTGTGAGGTTAC
AGTTGGATCGGGTGCAGAAGAGGATTGCAGACCGGAAGATGAAAATGCAA
GTGACCGATGCAGCTATTCAGCTCCTTGGGAGTCTTGGGTATGACCCCAA
CTATGGTGCAAGGCCGGTCAAGAGGGTGATTCAGCAGTACGTTGAAAATG
AGCTTGCCAAGGGCATTCTGAGAGGGGAGTTCAAGGATGATGACACAATT
GTAACAGACACTGAAGTTACAGCATTTTCCAATGGCCAGCTTCCGCAGCA
AAAGCTAGTCTTCAGGAGACTTGATACCAGTTCGGATGCTTCTGCTGCAG
ATAACCAAGAAGCTTTCTCACAGACAGCATAAATGTCTGTCCAATGTGTT
TAATTTTACGAAATTATATTTGTGTTCAGCAAAATTATGAGCGAATTTTC
TTAACTGATAGGCTGTAACCTGCTTCTTGTATATGATGATGCTTTATACA
AAATCATAAGCCTTGAAGTGTTTCTTTTTCAACGATCATCACAAATTCAC
ATTCGTTTTAT
back to top