DC900341

Overview
NameDC900341
Unique NameDC900341
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1583
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5657 contig Csv1_Contig5657:1..1588. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: CZOG1_MAIZE (Cis-zeatin O-glucosyltransferase 1 OS=Zea mays GN=CISZOG1 PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.005e-20
Identity = 56/162 (34.57%), Postives = 92/162 (56.79%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRP----DSVIGEGDA-----LAELVEGTKERGLLVS-WVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMK------DVCDRNVVEKMVNDLMV 1266
            +P  +VLYVSFG+ + L   Q+ E    L  SKQRF+WV+R     D     G++     L+E    T+  GL+++ W PQ E+LAH A A F++H GWNST+ES+  G P++ WP  +DQ  +S  + + +  GL ++      ++     ++K++ + M+
Sbjct:  265 QPPESVLYVSFGTTSCLHADQVAELAAALKGSKQRFVWVLRDADRADIYAESGESRHAMFLSEFTRETEGTGLVITGWAPQLEILAHGATAAFMSHCGWNSTIESLSHGKPVLAWPMHSDQPWDSELLCKYFKAGLLVRPWEKHAEIVPAQAIQKVIEEAML 426          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: CZOG2_MAIZE (Cis-zeatin O-glucosyltransferase 2 OS=Zea mays GN=CISZOG2 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.714e-20
Identity = 57/162 (35.19%), Postives = 90/162 (55.56%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRP----DSVIGEGDA-----LAELVEGTKERGLLVS-WVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMK------DVCDRNVVEKMVNDLMV 1266
            +P  +VLYVSFG+ + L   Q+ E    L  SKQRF+WV+R     D     GD+     L+E    T+  GL+V+ W PQ E+LAH A A F++H GWNS +ES+  G P++ WP  +DQ  +S  +   +  GL ++      ++     ++K++ + M+
Sbjct:  261 QPPESVLYVSFGTTSCLHADQVAELAAALKGSKQRFVWVLRDADRADIYAESGDSRHAKFLSEFTRETEGTGLVVTGWAPQLEILAHGATAAFMSHCGWNSIIESLSHGKPVLAWPMHSDQPWDSELLCNYFKAGLLVRPWEKHAEIIPAQAIQKVIEEAML 422          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: ANGT_GENTR (Anthocyanin 3'-O-beta-glucosyltransferase OS=Gentiana triflora PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 8.508e-20
Identity = 63/199 (31.66%), Postives = 96/199 (48.24%), Query Frame = 1
Query:  841 AVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELVEGTKER------GLLVS-WVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKD-----------VCDRNVVEKMVNDLMVERK-EEFXXXXXXXXXXXXXXXNEGGPSYCNLDRLIDDI 1380
            +V+YV FGS+      QL E   GL +S Q F+WV+R  + + E D      +G ++R      GL++  W PQ  +L H+AV  F++H GWNSTLE I  GV M+ WP FA+Q  N + ++++   G+ +             V  R  + K V  LM E +  +                  GG SY +L  L+ ++
Sbjct:  280 SVVYVCFGSMANFNAAQLHELAMGLEESGQEFIWVVR--TCVDEEDESKWFPDGFEKRVQENNKGLIIKGWAPQVLILEHEAVGAFVSHCGWNSTLEGICGGVAMVTWPLFAEQFYNEKLMTDILRTGVSVGSLQWSRVTTSAVVVKRESISKAVRRLMAEEEGVDIRNRAKALKEKAKKAVEGGGSSYSDLSALLVEL 476          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: UFOG4_MANES (Anthocyanidin 3-O-glucosyltransferase 4 (Fragment) OS=Manihot esculenta GN=GT4 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.895e-19
Identity = 72/210 (34.29%), Postives = 101/210 (48.10%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELVEGTKERGL------LVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLD----------MKDVC----DRNVVEKMVNDLMVERK--EEFXXXXXXXXXXXXXXXNEGGPSYCNLDRLIDDIKMMS 1392
            +PG +V+Y   GSI+ L   QL E   GL  + Q F+WVIR +    EG     L EG +ER        +  W PQ  +L+H A+  F TH GWNSTLE I AGVP++  P FA+Q  N + V EV  +G+           ++D C     +  V+K +  +M + K  EE                 EGG SY +++ LI  +   S
Sbjct:   30 EPG-SVIYACLGSISGLTSWQLAELGLGLESTNQPFIWVIR-EGEKSEGLEKWILEEGYEERKRKREDFWIRGWSPQVLILSHPAIGAFFTHCGWNSTLEGISAGVPIVACPLFAEQFYNEKLVVEVLGIGVSVGVEAAVTWGLEDKCGAVMKKEQVKKAIEIVMDKGKEGEERRRRAREIGEMAKRTIEEGGSSYLDMEMLIQYVSERS 237          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: IABG_MAIZE (Indole-3-acetate beta-glucosyltransferase OS=Zea mays GN=IAGLU PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.515e-19
Identity = 60/157 (38.22%), Postives = 81/157 (51.59%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIR-------PDSVIGEGDALAELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMK-----DVCDRNVVEKMVNDLM 1263
            KP R+V YVSFGS+  L   Q  E   GL+ + + FLWV+R       P  ++ E  A            ++V W PQ +VLAH AV  F+TH GWNSTLE++  GVPM+    + DQ  N+R V   W  G+  +      V  R  VE+ V  +M
Sbjct:  275 KPDRSVAYVSFGSLASLGNAQKEELARGLLAAGKPFLWVVRASDEHQVPRYLLAEATATGA--------AMVVPWCPQLDVLAHPAVGCFVTHCGWNSTLEALSFGVPMVAMALWTDQPTNARNVELAWGAGVRARRDAGAGVFLRGEVERCVRAVM 423          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: UGFGT_MEDTR (Flavonoid 3-O-glucosyltransferase OS=Medicago truncatula GN=UGT78G1 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 7.202e-19
Identity = 54/148 (36.49%), Postives = 80/148 (54.05%), Query Frame = 1
Query:  841 AVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIR--PDSVIGEGDALAELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKD-VCDRNVVEKMVNDLMVERK 1275
            +V+Y+SFGS+      +L      L +    F+W  R  P   + +G      +E TK +G +V+W PQ E+L H +V  FLTHSGWNS LE IV GVPMI  P+F DQ +N+     V  +G+ + + V  +  ++K +   M   K
Sbjct:  274 SVVYISFGSVVTPPPHELTALAESLEECGFPFIWSFRGDPKEKLPKG-----FLERTKTKGKIVAWAPQVEILKHSSVGVFLTHSGWNSVLECIVGGVPMISRPFFGDQGLNTILTESVLEIGVGVDNGVLTKESIKKALELTMSSEK 416          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: UFOG2_MANES (Anthocyanidin 3-O-glucosyltransferase 2 (Fragment) OS=Manihot esculenta GN=GT2 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 7.202e-19
Identity = 65/202 (32.18%), Postives = 98/202 (48.51%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIR----PDSVIGEGD---ALAELVEGTKER----GLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMK--------DVCDRNVVEKMVNDLMVERKEEFXXXXXXXXXXXXXXXNEGGPSYCNLDRLIDD 1377
            +P  +V+++ FGS+      QL E  + L +S  RFLW IR    PD +    D       L EG  ER    G ++ W PQ  VLAH A+ GF++H GWNS LES+  GVP+  WP +A+QQ N+  +     LG+++          + + + +E+ +  LM E  +E                 +GG S+ +L   I D
Sbjct:  142 QPEGSVVFLCFGSMGSFSEDQLKEIAYALENSGHRFLWSIRRPPPPDKIASPTDYEDPRDVLPEGFLERTVAVGKVIGWAPQVAVLAHPAIGGFVSHCGWNSVLESLWFGVPIATWPMYAEQQFNAFEMVVELGLGVEIDMGYRKESGIIVNSDKIERAIRKLM-ENSDEKRKKVKEMREKSKMALIDGGSSFISLGDFIKD 342          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: UFOG_GENTR (Anthocyanidin 3-O-glucosyltransferase OS=Gentiana triflora PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 6.097e-18
Identity = 47/125 (37.60%), Postives = 72/125 (57.60%), Query Frame = 1
Query:  841 AVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMK 1215
            +V+Y+SFG++      ++      L   K  FLW +R ++           ++ T   G +VSW PQ  VL + A+  F+TH GWNSTLESI   VP+I  P+F DQ++N+R V +VW +G+ +K
Sbjct:  270 SVVYLSFGTVINPPPNEMAALASTLESRKIPFLWSLRDEA---RKHLPENFIDRTSTFGKIVSWAPQLHVLENPAIGVFVTHCGWNSTLESIFCRVPVIGRPFFGDQKVNARMVEDVWKIGVGVK 391          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: UFOG1_MANES (Anthocyanidin 3-O-glucosyltransferase 1 OS=Manihot esculenta GN=GT1 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 3.026e-17
Identity = 68/205 (33.17%), Postives = 97/205 (47.32%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAE-------LVEGTKER--GL--LVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGL----------DMKDVCDRNVVEKMVNDLMVERKEEFXXXXXXXXXXXXXXXNEGGPSYCNLDRLIDDI 1380
            +P  +V+++ FGS       Q+ E    L DS  RFLW +      G  ++ ++       L EG  ER  G+  ++ W PQ  VLAH A  G ++HSGWNS LESI  GVP+  WP +A+QQ N+     V  LGL          D  ++   + +E+ +  LM +   +                 EGG SYC LD LI D+
Sbjct:  246 QPPSSVVFLCFGSNGSFSKDQVKEIACALEDSGHRFLWSLADHRAPGFLESPSDYEDLQEVLPEGFLERTSGIEKVIGWAPQVAVLAHPATGGLVSHSGWNSILESIWFGVPVATWPMYAEQQFNA--FQMVIELGLAVEIKMDYRNDSGEIVKCDQIERGIRCLM-KHDSDRRKKVKEMSEKSRGALMEGGSSYCWLDNLIKDM 447          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: UFOG6_MANES (Anthocyanidin 3-O-glucosyltransferase 6 (Fragment) OS=Manihot esculenta GN=GT6 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 8.241e-15
Identity = 48/140 (34.29%), Postives = 73/140 (52.14%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDA------LAELV-----EGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMK 1215
            +P  +V+++ FGS+      Q  E    L  S+ RFLW +R     G+ +       L E++     E T   G +V W PQ  +L H A+ GF++H GWNS LESI   VP+  WP +A+QQ N+  +     L +++K
Sbjct:  188 QPPSSVVFLCFGSMGGFDMDQAKEIACALEQSRHRFLWSLRRPPPKGKIETSTDYENLQEILPVGFSERTAGMGKVVGWAPQVAILEHPAIGGFVSHCGWNSILESIWFSVPIATWPLYAEQQFNAFTMVTELGLAVEIK 327          
The following BLAST results are available for this feature:
BLAST of DC900341 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
CZOG1_MAIZE1.005e-2034.57Cis-zeatin O-glucosyltransferase 1 OS=Zea mays GN=... [more]
CZOG2_MAIZE1.714e-2035.19Cis-zeatin O-glucosyltransferase 2 OS=Zea mays GN=... [more]
ANGT_GENTR8.508e-2031.66Anthocyanin 3'-O-beta-glucosyltransferase OS=Genti... [more]
UFOG4_MANES1.895e-1934.29Anthocyanidin 3-O-glucosyltransferase 4 (Fragment)... [more]
IABG_MAIZE5.515e-1938.22Indole-3-acetate beta-glucosyltransferase OS=Zea m... [more]
UGFGT_MEDTR7.202e-1936.49Flavonoid 3-O-glucosyltransferase OS=Medicago trun... [more]
UFOG2_MANES7.202e-1932.18Anthocyanidin 3-O-glucosyltransferase 2 (Fragment)... [more]
UFOG_GENTR6.097e-1837.60Anthocyanidin 3-O-glucosyltransferase OS=Gentiana ... [more]
UFOG1_MANES3.026e-1733.17Anthocyanidin 3-O-glucosyltransferase 1 OS=Manihot... [more]
UFOG6_MANES8.241e-1534.29Anthocyanidin 3-O-glucosyltransferase 6 (Fragment)... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900341 VSS Citrus sinensis cDNA clone VS28692 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900341 ID=DC900341|Name=DC900341|organism=Citrus sinensis|type=EST|length=1583bp
CTCATATCCTGATCTTTCCTCTCCCATGCCAAAGCCATATGAATTCCATG
CTCAAGCTTGCCGAGATTTTCGGCTTAGCTGGCCTCAAAGTGACCTTCCT
AAACTCCAAGCACAACCACGAACGCCTCATCCGGTACACGGATATCCATG
ANCGTTTTCTGCAGTATTCTGAATTCCAATTTAAGACCATCTCAGATGGT
CTTCCAGCGGATCACCCACGAGCAGGTGACCAATTGATGGAGATGTTCGA
TTCTTTGAGTTTGAATACCAGGCCACTTCTCAAACAGATGCTGATTGACA
CTAGCCCGCCAGTGAGCTGCATCATTGGAGATGCATGTATGGAATTTGTG
GTAGACGTTGCTACTGAACTTGAAATCCCTGTAATCCATTTTCGTGCTAT
AAGTGCTTGTAGCTTCTGGGCATATTTCTCTATCCCTGAAATGATCCAAG
CAGGCGAGCTTCCTATGAAAGCCTACGATGAAGACACGGATCGTCTGATA
ACAAAAGTTCCAGGCATGGAAACTTTTCTGAGATTCCGAGATCTCCCCAG
CTTTTGCCGAGTGAGTGACGTAACCGACCGAGATTTGCAAGTTCTTAAGA
ACGCGACCCAACAGTCCCCTCGAGCCCATGCTTTGATACTCAACACGTTT
GAAGACCTAGAAGAACCAATTCTGTCACATATACGCACCAATGNCCCAAA
GTGTACACAATAGGACCTCTTCACTTGCAGCTCAAGACAGGATTCGCCTC
AACATGATCTCATCGNCATTTCAAAGTCTCCAACAGTCTNTGGGAAGNGG
ACAGAAGTTGCATTGAATGGCTTGGTAAAAGCCTGGGCGGGCTGTACTGT
ACGTAAGCTTTGGTAGCATTACACTGTTGAAAANAGANCAGCTGATTGAG
TTTTGGCACGGTCTTGTAGACAGTAAGCAGCGGTTCTTGTGGGTCATTAG
GCCAGATTCTGTGATTGGCGAAGGTGACGCCCTGGCAGAGCTTGTGGAGG
GCACGAAGGAGAGAGGTCTTTTGGTTAGTTGGGTTCCACAGGAGGAGGTA
CTGGCTCACCAGGCTGTGGCTGGATTCTTGACACACAGCGGCTGGAACTC
AACCTTGGAGAGTATAGTAGCCGGGGTGCCAATGATTTGCTGGCCTTACT
TTGCTGATCAACAGATCAATAGTAGGTTTGTGAGTGAAGTGTGGAATCTT
GGATTGGATATGAAGGATGTGTGCGATAGAAATGTTGTTGAGAAAATGGT
GAATGATCTGATGGTGGAGAGGAAGGAGGAGTTTATGAGAGCAGCTGATC
GGATGGCTACAATGGCTAGAACCACTGCTAATGAAGGTGGACCATCTTAC
TGTAATTTGGACCGTCTGATTGATGATATTAAGATGATGAGCTCCCAAGC
ATGAAAACATATAGCTAAGGTTAGTGCAAGATGTTACTGCTAGATTAAAT
AAATTTTAAAGTTTAGAGATTCTTATCAATAAAAATTAATGTTATATGTA
CATCTGTCTTGATGACTGCTAGTACGCTACTACTAGATTATCTATTGGGA
ATGGCTGCGCTTGGCATTTTGTTAAAAAGTCAT
back to top