DC900313

Overview
NameDC900313
Unique NameDC900313
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1041
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5520 contig Csv1_Contig5520:36..1078. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_MAGSA (60 kDa chaperonin OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=groL PE=3 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 3.556e-71
Identity = 132/239 (55.23%), Postives = 178/239 (74.48%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+E+LG+ LE VNL+MLGT K++TI+K+DT I+DG+GDK +I+ RC+QIR+ +E +TSDYD+EKLQERLAKL+GGVAV+K+GG SE EV E+KDRV DAL+AT+AAVEEGIVPGGGV            ++ N DQ++G+ I++ AL+ PV  I             K+ E  +   G+DA  G Y DM+K+GIIDP KV+RTAL DAASV+ L+ TTEA++ E PK+
Sbjct:  290 EDIAILTGGQVISEDLGIKLESVNLEMLGTSKRITITKEDTTIVDGSGDKGAIDARCKQIRAQVEETTSDYDREKLQERLAKLAGGVAVIKVGGGSEIEVKERKDRVDDALHATRAAVEEGIVPGGGVALLHAVKALEGLASGNADQEVGISIVRRALQAPVRQIAENAGHDGAVVAGKIGESKDLSFGFDAQTGIYTDMIKAGIIDPTKVVRTALQDAASVAGLLITTEAMIAERPKK 528          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_DICDI (60 kDa heat shock protein, mitochondrial OS=Dictyostelium discoideum GN=hspA PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 2.305e-70
Identity = 135/239 (56.49%), Postives = 177/239 (74.06%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            QD+AV++G  +I+EELG+ LE V++ MLG+ KK+TI  D T+ILDGAGDK +I+ER E IR ++  +TSDYDK +L+ RLAK+ GGVAV+++GGASE EVGEKKDR+TDALNATKAAVEEGIVPGGG                NFDQ IGV+I+++AL  P  TI             +LL + + + GY+A KG Y +M+++GIIDP KV+RTAL+DAASV+SLMTTTEA+VVE+ K+
Sbjct:  306 QDIAVISGAQVISEELGVRLEDVDITMLGSAKKITIDSDSTIILDGAGDKAAIQERVELIRESLTRTTSDYDKTQLETRLAKIGGGVAVIRVGGASEVEVGEKKDRITDALNATKAAVEEGIVPGGGTALLYSTLALKKIKMDNFDQTIGVKIVRDALLIPCKTIANNAGVEGSVVIGRLLSKRDFEYGYNAQKGVYENMIQAGIIDPTKVVRTALIDAASVASLMTTTEAMVVEIKKD 544          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH602_RHORT (60 kDa chaperonin 2 OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) GN=groL2 PE=3 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 2.305e-70
Identity = 132/244 (54.10%), Postives = 178/244 (72.95%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTGG +I+E+LG+ LE V +DMLGT KKVTI+K++T ++DGAGDKK IE RC QIR+ IE+++SDYD+EKLQERLAKL+GGVAV+K+GGA+E EV EKKDRV DA++AT+AAVEEG+V GGGV              AN DQ +G++I++ AL+ PV  I             KLLE  +TD GY+A  G Y ++V +G+IDP KV+R AL  AAS++ L+ TTEA+V E+P++    P
Sbjct:  290 EDIAILTGGQVISEDLGIKLENVTIDMLGTAKKVTITKEETTLVDGAGDKKDIEARCSQIRANIEDTSSDYDREKLQERLAKLAGGVAVIKVGGATETEVKEKKDRVDDAMHATRAAVEEGVVAGGGVALLHAIRSLDSVKGANPDQNVGIEIVRRALQAPVRQIAENAGVDGAVVAGKLLENSDTDFGYNAQTGIYENLVTAGVIDPTKVVRAALQGAASIAGLLITTEAMVAEIPEKKDAMP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH601_BRASO (60 kDa chaperonin 1 OS=Bradyrhizobium sp. (strain ORS278) GN=groL1 PE=3 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 2.305e-70
Identity = 138/243 (56.79%), Postives = 177/243 (72.84%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEA 730
            +D+A+LTGG  I+E+LG+ LE V L MLG  KKV I K++T I+DGAG KK IE R +QIR  IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DAL+AT+AAVEEGI+PGGGV             TAN DQK GV II+ A++ PV  I             KLLE+D+   G++AA GEY D+V++G+IDP KV+RTAL DAASV+SL+ TTEA+V + PK+ + A
Sbjct:  290 EDIAILTGGTTISEDLGIKLENVTLSMLGRAKKVVIDKENTTIVDGAGAKKDIEARTQQIRLQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDALHATRAAVEEGILPGGGVALLRATKVLDGVKTANADQKAGVDIIRRAIQVPVRQIVQNAGDDGSLVVGKLLEKDSYSWGFNAATGEYQDLVQAGVIDPAKVVRTALQDAASVASLLITTEALVADKPKKAETA 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH601_ERYLH (60 kDa chaperonin 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=groL1 PE=3 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 6.706e-70
Identity = 135/244 (55.33%), Postives = 176/244 (72.13%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LT G++++EELG  LE V + MLG  KKV I KD+T I+DGAG+K  I+ R  QIR+ IE +TSDYD+EKLQER+AKL+GGVAV+++GGA+E EV E+KDRV DAL+AT+AAVEEGI+PGGG+              AN DQ+ G+ I++ AL+ P   I             KLLE D+ + G++AA GEY D+VKSG+IDP KV+RTAL DAASV+SL+ TTEA+V ELPKE   AP
Sbjct:  290 EDVAILTAGNVVSEELGTKLENVTIGMLGRAKKVIIDKDNTTIVDGAGNKADIDARVSQIRAQIETTTSDYDREKLQERVAKLAGGVAVIRVGGATEVEVKERKDRVDDALHATRAAVEEGILPGGGIALLRALKSLDGLKAANDDQQSGIDIVRRALRAPARQIAENAGEDGAYIVGKLLEGDDYNHGFNAATGEYEDLVKSGVIDPAKVVRTALQDAASVASLLITTEALVAELPKEDTPAP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH603_BRASB (60 kDa chaperonin 3 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=groL3 PE=3 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 1.494e-69
Identity = 136/239 (56.90%), Postives = 174/239 (72.80%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG  I+E+LG+ LE V L MLG  KKV I K++T I+DGAG KK IE R +QI+  IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DAL+AT+AAVEEGI+PGGGV             TAN DQK GV II+ A++ PV  I             KLLE+D    G++AA GEY D+V++G+IDP KV+RTAL DAASV+SL+ TTEA+V + PK+
Sbjct:  290 EDIAILTGGTTISEDLGIKLENVTLSMLGRAKKVVIDKENTTIVDGAGAKKDIEARTQQIKLQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDALHATRAAVEEGILPGGGVALLRATKVLDGVKTANADQKAGVDIIRRAIQVPVRQIVQNAGEDGSLVVGKLLEKDTYSWGFNAATGEYQDLVQAGVIDPAKVVRTALQDAASVASLLITTEALVADKPKK 528          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH605_SINMW (60 kDa chaperonin 5 OS=Sinorhizobium medicae (strain WSM419) GN=groL5 PE=3 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.951e-69
Identity = 138/244 (56.56%), Postives = 177/244 (72.54%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+I+K++T I+DGAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDR+ DALNAT+AAV+EGIVPGGGV               N DQ  GV I++ AL++P   I             K+LE+D  D GY+A  GEY DM+  GIIDP+KV+RTAL DAASV+SL+ TTEA++ ELPK  K+AP
Sbjct:  290 EDIAILTGGTVISEDLGIKLESVTLDMLGRAKKVSITKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALLRSSVKITVKG-ENDDQDAGVNIVRRALQSPARQIVENAGDEASIVVGKILEKDTDDFGYNAQTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPK--KDAP 530          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH601_SINMW (60 kDa chaperonin 1 OS=Sinorhizobium medicae (strain WSM419) GN=groL1 PE=3 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.951e-69
Identity = 138/244 (56.56%), Postives = 177/244 (72.54%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+I+K++T I+DGAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDR+ DALNAT+AAV+EGIVPGGGV               N DQ  GV I++ AL++P   I             K+LE+D  D GY+A  GEY DM+  GIIDP+KV+RTAL DAASV+SL+ TTEA++ ELPK  K+AP
Sbjct:  290 EDIAILTGGTVISEDLGIKLESVTLDMLGRAKKVSITKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALLRSSVKITVKG-ENDDQDAGVNIVRRALQSPARQIVENAGDEASIVVGKILEKDTDDFGYNAQTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPK--KDAP 530          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_RICTY (60 kDa chaperonin OS=Rickettsia typhi GN=groL PE=3 SV=2)

HSP 1 Score: 262.307 bits (669), Expect = 3.328e-69
Identity = 137/242 (56.61%), Postives = 177/242 (73.14%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKE 727
            +D+A+LT G+LITE+LGM LE VN+  LGT K+VTISK++TVI+DG GDKK+IE+R  QI+S I  +TSDYDKEKLQERLAKLSGGVAVLK+GGA+E EV E+KDRV DAL AT+AAVEEG+V GGGV               N DQ+ G++I+  ALK P+  I             KLLE ++ + G++A   +YVDM+K+GIIDP KV+RTAL DAASV+SL+ TTE ++V+ P + +E
Sbjct:  290 EDIAILTKGELITEDLGMKLENVNIKNLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDYDKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLLHASQTLTKLKVENKDQQAGIEIVIEALKDPLKQIVKNAGENGGVVVGKLLEHNDKNYGFNAQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSDKEE 531          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_RICPR (60 kDa chaperonin OS=Rickettsia prowazekii GN=groL PE=3 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 3.328e-69
Identity = 137/242 (56.61%), Postives = 177/242 (73.14%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKE 727
            +D+A+LT G+LITE+LGM LE VN+  LGT K+VTISK++TVI+DG GDKK+IE+R  QI+S I  +TSDYDKEKLQERLAKLSGGVAVLK+GGA+E EV E+KDRV DAL AT+AAVEEG+V GGGV               N DQ+ G++I+  ALK P+  I             KLLE ++ + G++A   +YVDM+K+GIIDP KV+RTAL DAASV+SL+ TTE ++V+ P + +E
Sbjct:  290 EDIAILTKGELITEDLGMKLENVNIKNLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDYDKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLLHASQTLTKLKVENKDQQAGIEIVIEALKDPLKQIVKNAGENGGVVVGKLLEHNDKNYGFNAQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSDKEE 531          
The following BLAST results are available for this feature:
BLAST of DC900313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_MAGSA3.556e-7155.2360 kDa chaperonin OS=Magnetospirillum magneticum (... [more]
CH60_DICDI2.305e-7056.4960 kDa heat shock protein, mitochondrial OS=Dictyo... [more]
CH602_RHORT2.305e-7054.1060 kDa chaperonin 2 OS=Rhodospirillum rubrum (stra... [more]
CH601_BRASO2.305e-7056.7960 kDa chaperonin 1 OS=Bradyrhizobium sp. (strain ... [more]
CH601_ERYLH6.706e-7055.3360 kDa chaperonin 1 OS=Erythrobacter litoralis (st... [more]
CH603_BRASB1.494e-6956.9060 kDa chaperonin 3 OS=Bradyrhizobium sp. (strain ... [more]
CH605_SINMW1.951e-6956.5660 kDa chaperonin 5 OS=Sinorhizobium medicae (stra... [more]
CH601_SINMW1.951e-6956.5660 kDa chaperonin 1 OS=Sinorhizobium medicae (stra... [more]
CH60_RICTY3.328e-6956.6160 kDa chaperonin OS=Rickettsia typhi GN=groL PE=3... [more]
CH60_RICPR3.328e-6956.6160 kDa chaperonin OS=Rickettsia prowazekii GN=groL... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900313 VSS Citrus sinensis cDNA clone VS28663 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900313 ID=DC900313|Name=DC900313|organism=Citrus sinensis|type=EST|length=1041bp
GCAGGATCTGGCTGTTCTCACTGGTGGTGATCTGATAACTGAAGAGCTCG
GCATGGACCTTGAGAAAGTGAATCTGGATATGCTCGGCACTTGCAAAAAG
GTTACAATATCGAAGGATGACACTGTCATTCTGGACGGTGCTGGTGATAA
GAAGTCCATTGAAGAAAGATGTGAACAGATTAGGTCTGCGATTGAGAACA
GCACTTCTGATTATGACAAGGAGAAGTTGCAAGAAAGATTGGCAAAGCTT
TCTGGTGGTGTTGCTGTGTTGAAGATTGGAGGAGCTAGTGAAGCTGAAGT
TGGTGAGAAGAAAGATAGAGTTACTGATGCTTTGAATGCGACAAAGGCAG
CTGTAGAAGAGGGTATTGTGCCGGGTGGTGGTGTTGCCCTTCTATATGCG
GCAAAAGAGTTGGAAAAGCTGTCCACTGCTAACTTTGACCAGAAGATTGG
TGTTCAGATTATTCAGAATGCTCTAAAGACACCAGTGCACACAATTGCTG
CTAATGCAGGAGTTGAGGGGGCTGTTGTGGTTGGTAAGCTATTGGAGCAG
GACAACACTGACCTTGGGTATGATGCCGCCAAAGGTGAGTATGTTGATAT
GGTCAAATCTGGAATTATCGATCCATTGAAAGTAATCAGAACTGCTTTGG
TTGATGCTGCAAGTGTATCATCTTTAATGACCACAACTGAAGCTATTGTT
GTTGAGCTGCCTAAGGAGGANAAGGAAGCTCCGGGAGGCATGGGTGGCAT
GGGCGGAATGGGCGGCATGGACTATTGAAATCCCAGTANAATGCTTAACT
GATTGTCCCTTTTTTTTTTTTTTGGGGTTCCATAATCAACATACAATCTG
AATGTTAGGATTTTGTGGCCAGCTTAATNANAAAAAANTGTGTCAATCAT
AAGGCATCCTTGTAATCATAGTGANAGGTAGGCATTTAGGTCGTTTGGCA
ATTTAGGATAAAACATTGCTGATTTAGGTCGTTTGGCAATCCNCTTGGAT
GATTGGTTGGTTTTTAATTGAACTGGATTTTNTTTCCCATT
back to top