DC900313

Overview
NameDC900313
Unique NameDC900313
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1041
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5520 contig Csv1_Contig5520:36..1078. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_CAUSK (60 kDa chaperonin OS=Caulobacter sp. (strain K31) GN=groL PE=3 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 1.826e-67
Identity = 130/239 (54.39%), Postives = 171/239 (71.55%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTG  +I+E+LG+ LE V+LDMLG  KKV+I+KDDT I+DG G+K +IE R  QI+  IE++TSDYDKEKLQERLAKL+GGVAV+++GG++E EV EKKDRV DALNAT+AAVEEGIVPGGGV               N DQ  G+ I++ AL+ P+  I             K+LE D+   G++A   +YVD++  G+IDP KV+RTAL DAASV+ L+ TTEA +VE PK+
Sbjct:  290 EDIAILTGAQVISEDLGIKLENVSLDMLGKAKKVSITKDDTTIVDGVGEKTAIEARIGQIKKQIEDTTSDYDKEKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALLKASKALATLVGDNDDQTAGIAIVRRALQAPIRQIAENAGVEGSIVVGKILENDSPTFGFNAQTEQYVDLIADGVIDPAKVVRTALQDAASVAGLLITTEAAIVEAPKK 528          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_ACICJ (60 kDa chaperonin OS=Acidiphilium cryptum (strain JF-5) GN=groL PE=3 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 1.826e-67
Identity = 134/244 (54.92%), Postives = 173/244 (70.90%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTGG +I+E+LG+ LE V L+MLG  KKV I K++T I++GAG K  I  RC QIR+ IE +TSDYD+EKLQERLAKL+GGVAV+++GGASE EV E+KDRV DAL+AT+AAVEEGIVPGGGV               N DQ+ G+ II+ A+  P+  I             K+L+ D+   G+DA  GE+ DMVK+GIIDP KV+RTAL DAASV+ L+ TTEA+V E P+  K+AP
Sbjct:  290 EDIAILTGGQVISEDLGIKLETVTLNMLGRAKKVLIEKENTTIVEGAGKKADITGRCNQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGASETEVKERKDRVDDALHATRAAVEEGIVPGGGVALARASLAINKLKADNDDQRFGIDIIRKAVLAPMRQIAENAGEDGAVISGKVLDNDDYSFGFDAQSGEFKDMVKAGIIDPTKVVRTALQDAASVAGLLITTEAMVAERPE--KKAP 531          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH604_BRASB (60 kDa chaperonin 4 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=groL4 PE=3 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 1.826e-67
Identity = 132/244 (54.10%), Postives = 172/244 (70.49%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            QD+A+LTGG  I+E+LG+ LE VNL MLG  KKV I K++T I++GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DA++AT+AAVEEGI+PGGGV             T N DQK GV+I++ AL  P   I             K+LE++    G+D+  G+YV+MV  GIIDP KV+RTA+ +AASV+SL+ TTEA+V ELPK+    P
Sbjct:  290 QDIAILTGGQAISEDLGIKLENVNLSMLGRAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGILPGGGVALLRASEQLKGLRTKNEDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKILEKEQYAYGFDSQTGDYVNMVSKGIIDPTKVVRTAIQNAASVASLLITTEAMVAELPKKNAGGP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH603_NITHX (60 kDa chaperonin 3 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=groL3 PE=3 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 1.826e-67
Identity = 133/239 (55.65%), Postives = 168/239 (70.29%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG LI+++LG+ LE V +DMLG  KKV I K++T I++GAG KK IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAV+EGIVPGGG             +  N D + G+ I+  AL+ P+  I             K+LE      G+DA K EYVDMV  GIIDP KV+RTAL DAASV+ L+ TTEA+V ELPKE
Sbjct:  290 EDIAILTGGQLISDDLGIKLENVTVDMLGRAKKVVIDKENTTIVNGAGKKKDIEARVGQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVEDALNATRAAVQEGIVPGGGTALLRAKKAVGRIANDNPDVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKVLENKTETFGFDAQKEEYVDMVAKGIIDPAKVVRTALQDAASVAGLLVTTEAMVAELPKE 528          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH601_MESSB (60 kDa chaperonin 1 OS=Mesorhizobium sp. (strain BNC1) GN=groL1 PE=3 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 1.826e-67
Identity = 133/244 (54.51%), Postives = 171/244 (70.08%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+AVLTGG +I+E+LG+ LE V LDMLG  K+V+I+K+ T I+DGAG K  IE R  QI+S IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAVEEGIVPGGG                N DQ+ GV I++ A++ P   I             K+L+ +    GY+A  GEY DM+  GI+DP+KV+RTAL DAASV+ L+ TTEA++ ELPK+   AP
Sbjct:  290 EDIAVLTGGQVISEDLGIKLENVTLDMLGRAKRVSIAKETTTIVDGAGQKSEIEGRVAQIKSQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGTALLRASSEIKAKG-ENADQEAGVNIVRRAIQAPARQIASNAGAEASIVVGKILDNNAVTFGYNAQTGEYGDMIGMGIVDPMKVVRTALQDAASVAGLLITTEAMIAELPKKDSPAP 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: HSP60_EMENI (Heat shock protein 60 OS=Emericella nidulans GN=hsp60 PE=1 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 2.385e-67
Identity = 135/242 (55.79%), Postives = 175/242 (72.31%), Query Frame = 2
Query:    5 DLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIEN-STSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGG-VXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDL--GYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            DL VLT G + T+EL + LEK+  DMLG+   +TI+K+DT+IL+G G K +I +RCEQIR  + + +TS+Y+KEKLQERLAKLSGGVAV+K+GGASE EVGEKKDRV DALNAT+AAVEEGI+PGGG                ANFDQ++GV I+++A+  P  TI             KL ++ + D   G+D+AKGEYVDM+ +GI+DPLKV+RTALVDA+ VSSL+ TTE  +VE P+E
Sbjct:  324 DLGVLTNGTVFTDELDIKLEKLTPDMLGSTGSITITKEDTIILNGEGSKDAIAQRCEQIRGVMADPTTSEYEKEKLQERLAKLSGGVAVIKVGGASEVEVGEKKDRVVDALNATRAAVEEGILPGGGTALLKAAANGLENVKPANFDQQLGVSIVKSAITRPARTIVENAGLEGSVIVGKLTDEFSKDFNRGFDSAKGEYVDMIAAGIVDPLKVVRTALVDASGVSSLLGTTEVAIVEAPEE 565          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH602_RHOP2 (60 kDa chaperonin 2 OS=Rhodopseudomonas palustris (strain HaA2) GN=groL2 PE=3 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 2.385e-67
Identity = 131/239 (54.81%), Postives = 171/239 (71.55%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            QD+A+LTGG  I+E+LG+ +E V L MLG  KKV I K++T I++GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DA++AT+AAVEEGIVPGGGV             TAN DQK GV+I++ AL  P   I             K+LE+D  + G+D+  GEY DMVK GIIDP KV+R A+ +AASV++L+ TTEA++ ELPK+
Sbjct:  290 QDIAILTGGQAISEDLGIKMENVTLQMLGRAKKVMIDKENTTIVNGAGKKVDIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEIEVKERKDRVDDAMHATRAAVEEGIVPGGGVALLRASEQLKRIKTANDDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKVLEKDQYNYGFDSQTGEYGDMVKKGIIDPTKVVRAAIQNAASVAALLITTEAMIAELPKK 528          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH601_NITHX (60 kDa chaperonin 1 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=groL1 PE=3 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 2.385e-67
Identity = 131/244 (53.69%), Postives = 171/244 (70.08%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            QD+A+LTGG  I+E+LG+ LE V L MLG  KKV I K++T I+ GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DA++AT+AAVEEGIVPGGGV             TAN DQK GV+I++ AL  P   I             K+LE++    G+D+  GEYV+++  GIIDP KV+R A+ +AASV++L+ TTEA+V ELPK+   AP
Sbjct:  290 QDIAILTGGQAISEDLGIKLENVTLAMLGRAKKVMIDKENTTIVSGAGKKADIEARVNQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVPGGGVALLRASEQLKRIKTANDDQKTGVEIVRKALSAPARQIAINAGEDGSIIVGKILEKEQYSYGFDSQTGEYVNLISKGIIDPTKVVRAAIQNAASVAALLITTEAMVAELPKKNAAAP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH601_RHOPS (60 kDa chaperonin 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=groL1 PE=3 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 3.115e-67
Identity = 131/239 (54.81%), Postives = 171/239 (71.55%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            QD+A+LTGG  I+E+LG+ +E V L MLG  KKV I K++T I++GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DA++AT+AAVEEGIVPGGGV             T N DQK GV+I++ AL  P   I             K+LE+D  + G+D+  GEY D+VK GIIDP KV+RTA+ +AASV++L+ TTEA+V ELPK+
Sbjct:  290 QDIAILTGGQAISEDLGIKMENVTLQMLGKAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEIEVKERKDRVDDAMHATRAAVEEGIVPGGGVALLRASEQLKRIKTQNDDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKVLEKDQYNYGFDSQTGEYGDLVKKGIIDPTKVVRTAIQNAASVAALLITTEAMVAELPKK 528          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH603_RHILO (60 kDa chaperonin 3 OS=Rhizobium loti GN=groL3 PE=3 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 4.068e-67
Identity = 132/239 (55.23%), Postives = 169/239 (70.71%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+ISK++T I+DGAG K+ I+ R  QI+  IE +TSDYDKEKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAVEEGIVPGGGV              AN DQ  G+ I++ AL+ P   I             K+LE      G++A  GEY DM+  GI+DP+KV+RTAL DAASV+ L+ TTEA++ E PK+
Sbjct:  290 EDIAILTGGQVISEDLGIKLENVGLDMLGRAKKVSISKENTTIVDGAGKKEEIQGRVAQIKQQIEETTSDYDKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALLRASLSINAVG-ANSDQTAGISIVRRALQAPARQIAANAGAEASIVAGKILENKGATFGFNAQTGEYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTTEAMIAEAPKK 527          
The following BLAST results are available for this feature:
BLAST of DC900313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_CAUSK1.826e-6754.3960 kDa chaperonin OS=Caulobacter sp. (strain K31) ... [more]
CH60_ACICJ1.826e-6754.9260 kDa chaperonin OS=Acidiphilium cryptum (strain ... [more]
CH604_BRASB1.826e-6754.1060 kDa chaperonin 4 OS=Bradyrhizobium sp. (strain ... [more]
CH603_NITHX1.826e-6755.6560 kDa chaperonin 3 OS=Nitrobacter hamburgensis (s... [more]
CH601_MESSB1.826e-6754.5160 kDa chaperonin 1 OS=Mesorhizobium sp. (strain B... [more]
HSP60_EMENI2.385e-6755.79Heat shock protein 60 OS=Emericella nidulans GN=hs... [more]
CH602_RHOP22.385e-6754.8160 kDa chaperonin 2 OS=Rhodopseudomonas palustris ... [more]
CH601_NITHX2.385e-6753.6960 kDa chaperonin 1 OS=Nitrobacter hamburgensis (s... [more]
CH601_RHOPS3.115e-6754.8160 kDa chaperonin 1 OS=Rhodopseudomonas palustris ... [more]
CH603_RHILO4.068e-6755.2360 kDa chaperonin 3 OS=Rhizobium loti GN=groL3 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900313 VSS Citrus sinensis cDNA clone VS28663 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900313 ID=DC900313|Name=DC900313|organism=Citrus sinensis|type=EST|length=1041bp
GCAGGATCTGGCTGTTCTCACTGGTGGTGATCTGATAACTGAAGAGCTCG
GCATGGACCTTGAGAAAGTGAATCTGGATATGCTCGGCACTTGCAAAAAG
GTTACAATATCGAAGGATGACACTGTCATTCTGGACGGTGCTGGTGATAA
GAAGTCCATTGAAGAAAGATGTGAACAGATTAGGTCTGCGATTGAGAACA
GCACTTCTGATTATGACAAGGAGAAGTTGCAAGAAAGATTGGCAAAGCTT
TCTGGTGGTGTTGCTGTGTTGAAGATTGGAGGAGCTAGTGAAGCTGAAGT
TGGTGAGAAGAAAGATAGAGTTACTGATGCTTTGAATGCGACAAAGGCAG
CTGTAGAAGAGGGTATTGTGCCGGGTGGTGGTGTTGCCCTTCTATATGCG
GCAAAAGAGTTGGAAAAGCTGTCCACTGCTAACTTTGACCAGAAGATTGG
TGTTCAGATTATTCAGAATGCTCTAAAGACACCAGTGCACACAATTGCTG
CTAATGCAGGAGTTGAGGGGGCTGTTGTGGTTGGTAAGCTATTGGAGCAG
GACAACACTGACCTTGGGTATGATGCCGCCAAAGGTGAGTATGTTGATAT
GGTCAAATCTGGAATTATCGATCCATTGAAAGTAATCAGAACTGCTTTGG
TTGATGCTGCAAGTGTATCATCTTTAATGACCACAACTGAAGCTATTGTT
GTTGAGCTGCCTAAGGAGGANAAGGAAGCTCCGGGAGGCATGGGTGGCAT
GGGCGGAATGGGCGGCATGGACTATTGAAATCCCAGTANAATGCTTAACT
GATTGTCCCTTTTTTTTTTTTTTGGGGTTCCATAATCAACATACAATCTG
AATGTTAGGATTTTGTGGCCAGCTTAATNANAAAAAANTGTGTCAATCAT
AAGGCATCCTTGTAATCATAGTGANAGGTAGGCATTTAGGTCGTTTGGCA
ATTTAGGATAAAACATTGCTGATTTAGGTCGTTTGGCAATCCNCTTGGAT
GATTGGTTGGTTTTTAATTGAACTGGATTTTNTTTCCCATT
back to top