DC900313

Overview
NameDC900313
Unique NameDC900313
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1041
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5520 contig Csv1_Contig5520:36..1078. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH602_NITWN (60 kDa chaperonin 2 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=groL2 PE=3 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 6.939e-67
Identity = 130/244 (53.28%), Postives = 171/244 (70.08%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            QD+A+LTGG  I+E+LG+ LE V L MLG  KKV I K++T I++GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DA++AT+AAVEEGIVPGGGV             T N DQK GV+I++ AL  P   I             K+LE++    G+D+  G+Y +++  GIIDP KV+RTA+ +AASV+SL+ TTEA+V ELPK+   AP
Sbjct:  290 QDIAILTGGQAISEDLGIKLENVTLQMLGRAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVPGGGVALLRASEQLKRIKTQNDDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKILEKEQYSYGFDSQTGDYGNLISKGIIDPTKVVRTAIQNAASVASLLITTEAMVAELPKKNSPAP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: HSP60_PARBA (Heat shock protein 60, mitochondrial OS=Paracoccidioides brasiliensis (strain ATCC MYA-826 / Pb01) GN=HSP60 PE=1 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 9.063e-67
Identity = 134/242 (55.37%), Postives = 172/242 (71.07%), Query Frame = 2
Query:    5 DLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIEN-STSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGG-VXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDL--GYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            D+ +LT   + T+EL + LEK   DMLG+   +TI+K+DT+IL+G G K +I +RCEQIRS I + +TSDY+KEKLQERLAKLSGGVAV+K+GGASE EVGEKKDRV DALNAT+AAVEEGI+PGGG              +  NFDQK+G+ II+NA+  P  TI             KL +    D   G+D+A+GEYVDM+ +GI+DPLKV+RTALVDA+ V+SL+ TTE  +VE P+E
Sbjct:  328 DIGILTNATVFTDELDLKLEKATPDMLGSTGSITITKEDTIILNGEGSKDAIAQRCEQIRSVISDPATSDYEKEKLQERLAKLSGGVAVIKVGGASEIEVGEKKDRVVDALNATRAAVEEGILPGGGTALLKAAANGLTSLNPTNFDQKLGISIIKNAITRPARTIVENSGLEGSVIVGKLTDDFAGDFNRGFDSARGEYVDMIGAGIVDPLKVVRTALVDASGVASLLGTTEVAIVEAPEE 569          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH607_BRAJA (60 kDa chaperonin 7 OS=Bradyrhizobium japonicum GN=groL7 PE=3 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 9.063e-67
Identity = 134/244 (54.92%), Postives = 171/244 (70.08%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +DLA+LTGG LI+EELG+ LE V + MLG  KKV I K++T I++GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAV+EGIVPGGGV            + AN D + G+ I+  AL+ P+  I             K+LE  +   G+DA   +YVDMV+ GIIDP KV+RTAL DA+SV+ L+ TTEA+V E PK  K+AP
Sbjct:  290 EDLAILTGGQLISEELGIKLENVTVKMLGRAKKVVIDKENTTIVNGAGKKPDIEARVGQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVEDALNATRAAVQEGIVPGGGVALLRAKKAVGRLTNANDDVQAGINIVLKALEAPIRQISENAGVEGSIVVGKILENKSETFGFDAQNEDYVDMVEKGIIDPAKVVRTALQDASSVAGLLVTTEAMVAEAPK--KDAP 531          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH602_RHOPS (60 kDa chaperonin 2 OS=Rhodopseudomonas palustris (strain BisB5) GN=groL2 PE=3 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 9.063e-67
Identity = 131/243 (53.91%), Postives = 170/243 (69.96%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEA 730
            +D+A+LTGG LI+EELG+ LE V L MLG  KKV I K++T I++GAG K  IE R +QI++ IE ++SDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAV+EGIVPGGGV            +  N D + G+ I+  AL+ P+  I             K+LE  +   G+DA   EYVDM+  GI+DP KV+RTAL DAASV++L+ TTEA+V ELP+E   A
Sbjct:  290 EDIAILTGGQLISEELGVKLESVTLKMLGRAKKVVIDKENTTIVNGAGKKADIEARVQQIKAQIEETSSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALLRAKKAVGRINNDNADVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKSETFGFDAQTEEYVDMLAKGIVDPAKVVRTALQDAASVAALLVTTEAMVAELPREAAPA 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH601_BRASB (60 kDa chaperonin 1 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=groL1 PE=3 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 9.063e-67
Identity = 132/243 (54.32%), Postives = 169/243 (69.55%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEA 730
            +D+A+LTGG LI+++LGM LE V + MLG  KKV I K++T I++GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAV+EGIVPGGGV            +  N D + G+ I+  AL+ PV  I             K+LE+ +   G+DA   +YVDMV  GIIDP KV+RTAL DA+SV+ L+ TTEA+V ELPKE   A
Sbjct:  290 EDIAILTGGQLISDDLGMKLENVTIKMLGRAKKVVIDKENTTIVNGAGKKADIEARVGQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVEDALNATRAAVQEGIVPGGGVALLRAKKAVGRITNPNSDVQAGINIVLKALEAPVRQIAENAGVEGSLVVGKILEEKSETFGFDAQSEDYVDMVAKGIIDPAKVVRTALQDASSVAGLLVTTEAMVAELPKEAAPA 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_MARMM (60 kDa chaperonin OS=Maricaulis maris (strain MCS10) GN=groL PE=3 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 1.184e-66
Identity = 133/239 (55.65%), Postives = 166/239 (69.46%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +DLA+LTGG +I+E+LG+ LE V LDMLG+ K+V I+KDDT I+DG GDK  IE R  QIR   E +TSDYD+EKLQERLAKL+GGVAV+K+GGA+E EV EKKDRV DALNAT+AAVEEGIVPGGGV               N DQ  G+ I+  AL++P+  I             K++E  +   G++A   EY DM+  G+IDP KV+RTAL DAASV+SL+ TTEA V + PKE
Sbjct:  290 EDLAILTGGQVISEDLGIKLETVTLDMLGSAKRVNITKDDTTIVDGVGDKAQIEARVTQIRRQSEETTSDYDREKLQERLAKLAGGVAVIKVGGATEIEVKEKKDRVDDALNATRAAVEEGIVPGGGVALLKASAKLAGLEGDNADQTQGIAIVARALQSPIRQIATNSGVEGSIVVGKVMENPSATFGFNAQTEEYGDMLAFGVIDPAKVVRTALQDAASVASLLITTEAAVADAPKE 528          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH602_RHOPA (60 kDa chaperonin 2 OS=Rhodopseudomonas palustris GN=groL2 PE=3 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 1.184e-66
Identity = 129/239 (53.97%), Postives = 170/239 (71.13%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            QD+A+LTGG  I+E+LG+ +E V L MLG  KKV I K++T I++GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DA++AT+AAVEEGIVPGGGV             T N DQK GV+I++ AL  P   I             K+LE++    G+D+  GEY D+VK GIIDP KV+RTA+ +AASV++L+ TTEA++ ELPK+
Sbjct:  290 QDIAILTGGQAISEDLGIKMENVTLQMLGRAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVPGGGVALLRASEQLKGLKTKNDDQKTGVEIVRRALSAPARQIAINAGEDGSVIVGKVLEKEQYAFGFDSQSGEYGDLVKKGIIDPTKVVRTAIQNAASVAALLITTEAMIAELPKK 528          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_RHOCS (60 kDa chaperonin OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=groL PE=3 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 2.019e-66
Identity = 130/244 (53.28%), Postives = 175/244 (71.72%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTGG +++E+LG+ LE V+L+MLG  KKV I+KD+T I+DGAG K+ I+ R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DA++AT+AAVEEGIV GGGV            +  N DQK G+ I++ AL+ PV  I             KLLE+  T+ G++A  GEY DM K G+IDP KV+R AL DAASV+ L+ TTEA++ E P+  K+AP
Sbjct:  290 EDMAILTGGQVVSEDLGIKLENVSLEMLGQAKKVVITKDNTTIVDGAGSKEDIQARIVQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVAGGGVALLYATKALDKLTAVNEDQKFGIDIVRKALQAPVRQIAQNAGFDGSVIVGKLLEKGETNFGFNAQAGEYGDMFKFGVIDPTKVVRAALQDAASVAGLLITTEAMIGEKPE--KKAP 531          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH606_BRAJA (60 kDa chaperonin 6 OS=Bradyrhizobium japonicum GN=groL6 PE=3 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 2.019e-66
Identity = 131/244 (53.69%), Postives = 170/244 (69.67%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            QD+A+LTGG  I+E+LG+ LE V L+MLG  KKV I K++T I++GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DA++AT+AAVEEGIVPGGGV             T N DQK GV+I++ AL  P   I             K+LE      G+D+  GEYV++V  GIIDP KV+RTA+ +AASV++L+ TTEA+V ELPK+    P
Sbjct:  290 QDIAILTGGQAISEDLGIKLENVTLNMLGRAKKVMIDKENTTIVNGAGKKADIEARVSQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVPGGGVALLRASEQLKGLRTKNDDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKILENKTYAYGFDSQTGEYVNLVTKGIIDPTKVVRTAIQNAASVAALLITTEAMVAELPKKGGAGP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH601_NITWN (60 kDa chaperonin 1 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=groL1 PE=3 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 2.019e-66
Identity = 131/239 (54.81%), Postives = 171/239 (71.55%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG  I+E+LG+ LE V L+MLG  KKV I K++T I+DGAG KK IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DA++AT+AAVEEGI+PGGGV               N DQK GV I++ A++ P   I             KLLE++  + G++AA GEY D+V  G+IDP KV+RTAL DAASV+SL+ TTEA+V E PK+
Sbjct:  290 EDIAILTGGTAISEDLGIKLENVTLNMLGRAKKVVIDKENTTIVDGAGRKKDIEARVTQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGILPGGGVALLRALKALDAVKPDNPDQKAGVDIVRRAIQVPARQIIQNAGEDGSLVVGKLLEKNTYNWGFNAATGEYQDLVGVGVIDPAKVVRTALQDAASVASLLITTEALVAEKPKK 528          
The following BLAST results are available for this feature:
BLAST of DC900313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH602_NITWN6.939e-6753.2860 kDa chaperonin 2 OS=Nitrobacter winogradskyi (s... [more]
HSP60_PARBA9.063e-6755.37Heat shock protein 60, mitochondrial OS=Paracoccid... [more]
CH607_BRAJA9.063e-6754.9260 kDa chaperonin 7 OS=Bradyrhizobium japonicum GN... [more]
CH602_RHOPS9.063e-6753.9160 kDa chaperonin 2 OS=Rhodopseudomonas palustris ... [more]
CH601_BRASB9.063e-6754.3260 kDa chaperonin 1 OS=Bradyrhizobium sp. (strain ... [more]
CH60_MARMM1.184e-6655.6560 kDa chaperonin OS=Maricaulis maris (strain MCS1... [more]
CH602_RHOPA1.184e-6653.9760 kDa chaperonin 2 OS=Rhodopseudomonas palustris ... [more]
CH60_RHOCS2.019e-6653.2860 kDa chaperonin OS=Rhodospirillum centenum (stra... [more]
CH606_BRAJA2.019e-6653.6960 kDa chaperonin 6 OS=Bradyrhizobium japonicum GN... [more]
CH601_NITWN2.019e-6654.8160 kDa chaperonin 1 OS=Nitrobacter winogradskyi (s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900313 VSS Citrus sinensis cDNA clone VS28663 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900313 ID=DC900313|Name=DC900313|organism=Citrus sinensis|type=EST|length=1041bp
GCAGGATCTGGCTGTTCTCACTGGTGGTGATCTGATAACTGAAGAGCTCG
GCATGGACCTTGAGAAAGTGAATCTGGATATGCTCGGCACTTGCAAAAAG
GTTACAATATCGAAGGATGACACTGTCATTCTGGACGGTGCTGGTGATAA
GAAGTCCATTGAAGAAAGATGTGAACAGATTAGGTCTGCGATTGAGAACA
GCACTTCTGATTATGACAAGGAGAAGTTGCAAGAAAGATTGGCAAAGCTT
TCTGGTGGTGTTGCTGTGTTGAAGATTGGAGGAGCTAGTGAAGCTGAAGT
TGGTGAGAAGAAAGATAGAGTTACTGATGCTTTGAATGCGACAAAGGCAG
CTGTAGAAGAGGGTATTGTGCCGGGTGGTGGTGTTGCCCTTCTATATGCG
GCAAAAGAGTTGGAAAAGCTGTCCACTGCTAACTTTGACCAGAAGATTGG
TGTTCAGATTATTCAGAATGCTCTAAAGACACCAGTGCACACAATTGCTG
CTAATGCAGGAGTTGAGGGGGCTGTTGTGGTTGGTAAGCTATTGGAGCAG
GACAACACTGACCTTGGGTATGATGCCGCCAAAGGTGAGTATGTTGATAT
GGTCAAATCTGGAATTATCGATCCATTGAAAGTAATCAGAACTGCTTTGG
TTGATGCTGCAAGTGTATCATCTTTAATGACCACAACTGAAGCTATTGTT
GTTGAGCTGCCTAAGGAGGANAAGGAAGCTCCGGGAGGCATGGGTGGCAT
GGGCGGAATGGGCGGCATGGACTATTGAAATCCCAGTANAATGCTTAACT
GATTGTCCCTTTTTTTTTTTTTTGGGGTTCCATAATCAACATACAATCTG
AATGTTAGGATTTTGTGGCCAGCTTAATNANAAAAAANTGTGTCAATCAT
AAGGCATCCTTGTAATCATAGTGANAGGTAGGCATTTAGGTCGTTTGGCA
ATTTAGGATAAAACATTGCTGATTTAGGTCGTTTGGCAATCCNCTTGGAT
GATTGGTTGGTTTTTAATTGAACTGGATTTTNTTTCCCATT
back to top