DC900313

Overview
NameDC900313
Unique NameDC900313
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1041
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5520 contig Csv1_Contig5520:36..1078. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH605_RHILO (60 kDa chaperonin 5 OS=Rhizobium loti GN=groL5 PE=3 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 4.498e-66
Identity = 131/239 (54.81%), Postives = 167/239 (69.87%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+E+LG+ LE V L+MLG  KKV+ISK++T I+DGAG K  I+ R  QI+  IE +TSDYDKEKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAVEEGIVPGGGV              AN DQ  G+ I++ AL+ P   I             K+LE      GY+A  GEY DM+  GI+DP+KV+RTAL DAASV+ L+ T EA++ E PK+
Sbjct:  290 EDIAILTGGQVISEDLGIKLENVGLNMLGRAKKVSISKENTTIVDGAGKKAEIQGRVAQIKQQIEETTSDYDKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALLRASLSINAVG-ANSDQTAGISIVRRALQAPARQIAANAGAEASIVAGKILENKGATYGYNAQTGEYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTAEAMIAEAPKK 527          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH603_BRASO (60 kDa chaperonin 3 OS=Bradyrhizobium sp. (strain ORS278) GN=groL3 PE=3 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 4.498e-66
Identity = 130/243 (53.50%), Postives = 169/243 (69.55%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEA 730
            +D+A+LTGG LI+++LGM LE V + MLG  KKV I K++T I++GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAV+EGIVPGGGV            +  N D + G+ I+  AL+ P+  I             K+LE+ +   G+DA   +YVDMV  GIIDP KV+RTAL DA+SV+ L+ TTEA+V ELPK+   A
Sbjct:  290 EDIAILTGGQLISDDLGMKLENVTIKMLGRAKKVVIDKENTTIVNGAGKKADIEARVGQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALLRAKKAVGRITNPNSDVQAGINIVLKALEAPMRQIAENAGVEGSIVVGKILEEKSETFGFDAQTEDYVDMVAKGIIDPAKVVRTALQDASSVAGLLVTTEAMVAELPKDAAPA 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH602_NITHX (60 kDa chaperonin 2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=groL2 PE=3 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 4.498e-66
Identity = 129/244 (52.87%), Postives = 170/244 (69.67%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            QD+A+LTGG  I+E+LG+ LE V L MLG  KKV I K++T I++GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DA++AT+AAVEEGIVPGGGV             TAN DQK GV+I++ AL  P   I             K+LE++    G+D+  GEY +++  GIIDP KV+R A+ +AASV++L+ TTEA+V ELPK+    P
Sbjct:  290 QDIAILTGGQAISEDLGIKLENVTLAMLGKAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVPGGGVALLRASEQLKRIKTANDDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKILEKEQYSYGFDSQSGEYGNLISKGIIDPTKVVRAAIQNAASVAALLITTEAMVAELPKKNAGGP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_RHILV (60 kDa chaperonin OS=Rhizobium leguminosarum bv. viciae GN=groL PE=2 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 5.875e-66
Identity = 131/244 (53.69%), Postives = 178/244 (72.95%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+ISK++T I+DG+G K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GG++E EV EKKDR+ DALNAT+AAV+EGIVPGGG+              AN DQ+ G+ I++ AL++ V  I             K+L+++  + GY+A   EY DM+  GI+DPLKV+RTAL +AASV+SL+ TTEA++ ELPK  K+AP
Sbjct:  290 EDIAILTGGTVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKTDIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGIALARSSTKITVKG-ANDDQEAGINIVRRALQSLVRQIAENAGDEASIVVGKVLDKNEDNFGYNAQTSEYGDMIAMGIVDPLKVVRTALQNAASVASLLITTEAMIAELPK--KDAP 530          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH601_RHOP5 (60 kDa chaperonin 1 OS=Rhodopseudomonas palustris (strain BisA53) GN=groL1 PE=3 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 5.875e-66
Identity = 130/243 (53.50%), Postives = 168/243 (69.14%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEA 730
            +D+A+LTGG LI+++LGM LE V L MLG  KKV I K++T I+ GAG K  IE R  QI++ IE ++SDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAV+EGIVPGGGV            +  N D + G+ I+  AL+ P+  I             K+LE  +   G+DA   EYVDM+  GI+DP KV+RTAL DAASVS+L+ TTEA+V ELP++   A
Sbjct:  290 EDIAILTGGQLISDDLGMKLENVTLKMLGRAKKVVIDKENTTIVGGAGKKADIESRVGQIKAQIEETSSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALLRAKKAVGRINNDNADVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKSETFGFDAQTEEYVDMLAKGIVDPAKVVRTALQDAASVSALLVTTEAMVAELPRDAAPA 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_METSB (60 kDa chaperonin OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=groL PE=3 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 7.672e-66
Identity = 131/243 (53.91%), Postives = 165/243 (67.90%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEA 730
            +D+A+LT G LI+EE+G+ LE V L MLG  K++ I K+ T I+DGAG K  IE R  QI+S I  +TSDYD+EK+QERLAKL+GGVAV+++GGASE EV EKKDRV DALNAT+AAVEEG++PGGGV            +  N DQK GV I++ A++TP   I             KL+E  +   GY+A   EY D+VK GIIDP KV+RTAL DAASV  L+ TTEAI+ E PK+   A
Sbjct:  290 EDIAILTSGTLISEEIGIKLENVTLQMLGRAKRIRIDKESTTIIDGAGAKGEIEARIAQIKSQIAETTSDYDREKMQERLAKLAGGVAVIRVGGASEVEVKEKKDRVDDALNATRAAVEEGVLPGGGVALLRAIKALEGLTVENADQKTGVDIVRKAIQTPARQIVDNSGGDGAVVVGKLIENPSYAYGYNAQTDEYGDLVKLGIIDPTKVVRTALQDAASVGGLLITTEAIIAEQPKKDSPA 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH605_RHIME (60 kDa chaperonin 5 OS=Rhizobium meliloti GN=groL5 PE=2 SV=2)

HSP 1 Score: 251.136 bits (640), Expect = 7.672e-66
Identity = 127/239 (53.14%), Postives = 169/239 (70.71%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +++E+LG+ LE V LDMLG  KKV+I K++T I+DGAG K  IE R  QIR+ IE +TSDYD+EKLQERLAKL+GGVAV+++GG++E EV EKKDRV DAL+AT+AAVEEGI+PGGGV             TAN DQ++GV +++ A++ PV  I             KL E+     G++A   EY D+   G+IDP KV+RTAL DAASV+ L+ TTEA++ E PK+
Sbjct:  290 EDIAILTGGTVVSEDLGIKLESVTLDMLGRAKKVSIEKENTTIIDGAGSKADIEGRTAQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALLRAVKALDGLKTANNDQRVGVDLVRRAIEAPVRQIAENAGAEGSIIVGKLREKTEFSYGWNAQTNEYGDLYAMGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPKK 528          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH604_RHILO (60 kDa chaperonin 4 OS=Rhizobium loti GN=groL4 PE=3 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 7.672e-66
Identity = 131/239 (54.81%), Postives = 168/239 (70.29%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+E+LG+ LE V L+MLG  KKV+ISK++T I+DGAG K  I+ R  QI+  IE +TSDYDKEKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAVEEGIV GGGV            + AN DQ  G+ I++ AL+ P   I             K+LE      GY+A  GEY DM+  GI+DP+KV+RTAL DAASV+ L+ TTEA++ E PK+
Sbjct:  290 EDIAILTGGQVISEDLGIKLENVGLNMLGRAKKVSISKENTTIVDGAGKKAEIQGRVAQIKQQIEETTSDYDKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGV-ALLRASANIKAAGANADQAAGINIVRRALQAPARQIASNAGAEASIVAGKILENKGATFGYNAQTGEYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTTEAMIAEAPKK 527          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH602_RHOP5 (60 kDa chaperonin 2 OS=Rhodopseudomonas palustris (strain BisA53) GN=groL2 PE=3 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 7.672e-66
Identity = 128/239 (53.56%), Postives = 170/239 (71.13%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            QD+A+LTGG  I+E+LG+ +E V L MLG  KKV I K++T I++GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DA++AT+AAVEEGIVPGGGV             T N DQK GV+I++ AL  P   I             K+LE+D  + G+D+  GEY ++V  GIIDP KV+RTA+ +AASV++L+ TTEA++ ELPK+
Sbjct:  290 QDIAILTGGQAISEDLGIKMENVTLAMLGKAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVPGGGVALLRASEQLKGLKTKNDDQKTGVEIVRKALSWPARQIAINAGEDGSVIVGKILEKDQYNYGFDSQSGEYGNLVSKGIIDPTKVVRTAIQNAASVAALLITTEAMIAELPKK 528          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH601_RHOPA (60 kDa chaperonin 1 OS=Rhodopseudomonas palustris GN=groL1 PE=3 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 1.002e-65
Identity = 130/238 (54.62%), Postives = 166/238 (69.75%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPK 715
            +D+A+LTGG LI+E+LG+ LE V L MLG  KKV I K++T I++GAG K  IE R  QI++ IE ++SDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAV+EGIVPGGGV            S  N D + G+ I+  AL+ P+  I             K+LE      G+DA   EYVDM+  GI+DP KV+RTAL DA+SV+SL+ TTEA+V ELPK
Sbjct:  290 EDIAILTGGQLISEDLGIKLETVTLKMLGRAKKVVIDKENTTIVNGAGKKPEIEARVSQIKAQIEETSSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALLRAKKAVGRISNDNPDVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKTETFGFDAQTEEYVDMLAKGIVDPAKVVRTALQDASSVASLLVTTEAMVAELPK 527          
The following BLAST results are available for this feature:
BLAST of DC900313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH605_RHILO4.498e-6654.8160 kDa chaperonin 5 OS=Rhizobium loti GN=groL5 PE=... [more]
CH603_BRASO4.498e-6653.5060 kDa chaperonin 3 OS=Bradyrhizobium sp. (strain ... [more]
CH602_NITHX4.498e-6652.8760 kDa chaperonin 2 OS=Nitrobacter hamburgensis (s... [more]
CH60_RHILV5.875e-6653.6960 kDa chaperonin OS=Rhizobium leguminosarum bv. v... [more]
CH601_RHOP55.875e-6653.5060 kDa chaperonin 1 OS=Rhodopseudomonas palustris ... [more]
CH60_METSB7.672e-6653.9160 kDa chaperonin OS=Methylocella silvestris (stra... [more]
CH605_RHIME7.672e-6653.1460 kDa chaperonin 5 OS=Rhizobium meliloti GN=groL5... [more]
CH604_RHILO7.672e-6654.8160 kDa chaperonin 4 OS=Rhizobium loti GN=groL4 PE=... [more]
CH602_RHOP57.672e-6653.5660 kDa chaperonin 2 OS=Rhodopseudomonas palustris ... [more]
CH601_RHOPA1.002e-6554.6260 kDa chaperonin 1 OS=Rhodopseudomonas palustris ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900313 VSS Citrus sinensis cDNA clone VS28663 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900313 ID=DC900313|Name=DC900313|organism=Citrus sinensis|type=EST|length=1041bp
GCAGGATCTGGCTGTTCTCACTGGTGGTGATCTGATAACTGAAGAGCTCG
GCATGGACCTTGAGAAAGTGAATCTGGATATGCTCGGCACTTGCAAAAAG
GTTACAATATCGAAGGATGACACTGTCATTCTGGACGGTGCTGGTGATAA
GAAGTCCATTGAAGAAAGATGTGAACAGATTAGGTCTGCGATTGAGAACA
GCACTTCTGATTATGACAAGGAGAAGTTGCAAGAAAGATTGGCAAAGCTT
TCTGGTGGTGTTGCTGTGTTGAAGATTGGAGGAGCTAGTGAAGCTGAAGT
TGGTGAGAAGAAAGATAGAGTTACTGATGCTTTGAATGCGACAAAGGCAG
CTGTAGAAGAGGGTATTGTGCCGGGTGGTGGTGTTGCCCTTCTATATGCG
GCAAAAGAGTTGGAAAAGCTGTCCACTGCTAACTTTGACCAGAAGATTGG
TGTTCAGATTATTCAGAATGCTCTAAAGACACCAGTGCACACAATTGCTG
CTAATGCAGGAGTTGAGGGGGCTGTTGTGGTTGGTAAGCTATTGGAGCAG
GACAACACTGACCTTGGGTATGATGCCGCCAAAGGTGAGTATGTTGATAT
GGTCAAATCTGGAATTATCGATCCATTGAAAGTAATCAGAACTGCTTTGG
TTGATGCTGCAAGTGTATCATCTTTAATGACCACAACTGAAGCTATTGTT
GTTGAGCTGCCTAAGGAGGANAAGGAAGCTCCGGGAGGCATGGGTGGCAT
GGGCGGAATGGGCGGCATGGACTATTGAAATCCCAGTANAATGCTTAACT
GATTGTCCCTTTTTTTTTTTTTTGGGGTTCCATAATCAACATACAATCTG
AATGTTAGGATTTTGTGGCCAGCTTAATNANAAAAAANTGTGTCAATCAT
AAGGCATCCTTGTAATCATAGTGANAGGTAGGCATTTAGGTCGTTTGGCA
ATTTAGGATAAAACATTGCTGATTTAGGTCGTTTGGCAATCCNCTTGGAT
GATTGGTTGGTTTTTAATTGAACTGGATTTTNTTTCCCATT
back to top