DC900313

Overview
NameDC900313
Unique NameDC900313
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1041
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5520 contig Csv1_Contig5520:36..1078. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH601_RHOP2 (60 kDa chaperonin 1 OS=Rhodopseudomonas palustris (strain HaA2) GN=groL1 PE=3 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 1.002e-65
Identity = 129/243 (53.09%), Postives = 168/243 (69.14%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEA 730
            +D+A+LTGG LI+EE+G+ LE V L MLG  KKV I K++T I+ GAG K  IE R +QI++ IE ++SDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAV+EGIVPGGGV               N D + G+ I+  AL+ P+  I             K+LE  +   G+DA   +YVDM+  GI+DP KV+RTAL DA+SV++L+ TTEA+V ELPKE   A
Sbjct:  290 EDIAILTGGQLISEEIGIKLESVTLKMLGRAKKVVIDKENTTIVGGAGKKPDIEARVQQIKAQIEETSSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALLRAKKAVGRIHNDNADVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKSETFGFDAQTEDYVDMLAKGIVDPAKVVRTALQDASSVAALLVTTEAMVAELPKEAAPA 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_SULSY (60 kDa chaperonin OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=groL PE=3 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 1.309e-65
Identity = 126/244 (51.64%), Postives = 171/244 (70.08%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            QD+A+LTGG  ITE+LG+ LE V+LDMLG   KV + KD+T I+ G G+ + I+ R EQI+  IE +TS+YDKEKLQERLAKL+GGVA++K+G A+EAE+ EKKDRV DA++ATKAAVEEGIVPGGG+               N D+  G++I++NA K P+  I             K+ + DN + G+DAA GEYVDMV++GIIDP KV+RTAL +AAS++  M T E +V E+ ++ ++ P
Sbjct:  290 QDIAILTGGTAITEDLGIKLESVDLDMLGKADKVVVDKDNTTIIGGKGNPEDIKARIEQIKKQIETTTSEYDKEKLQERLAKLAGGVAIIKVGAATEAELKEKKDRVDDAVHATKAAVEEGIVPGGGIAIFRASRALCNIKEENTDKAWGIKIVKNACKVPLKQIAYNAGFEGSVIIEKIKDVDNVNYGFDAATGEYVDMVEAGIIDPTKVVRTALQNAASIAGTMLTAECLVAEIKEKEEKLP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_JANSC (60 kDa chaperonin OS=Jannaschia sp. (strain CCS1) GN=groL PE=3 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 1.309e-65
Identity = 130/237 (54.85%), Postives = 164/237 (69.20%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELP 712
            QD+A+LTGG +I E+LGM LE V +DMLGT K++TISKD+T I+DGAG+K  IE R  QIR  IE STSDYD+EKLQER+AKL+GGVAV+K+GG SE EV E+KDRV DALNAT+AAV+EGIV GGGV               N DQ  G+ I++ AL+ P+  I             K+ E D+   G++A   EY D+ K G+IDP KV+RTAL DAASV+ L+ TTEA+V + P
Sbjct:  289 QDIAILTGGQVIAEDLGMKLESVTMDMLGTAKRLTISKDETTIVDGAGNKPEIEARVAQIRQQIEESTSDYDREKLQERVAKLAGGVAVIKVGGMSEIEVKERKDRVDDALNATRAAVQEGIVVGGGVALVQGGKSLAGLEGENADQNAGIAIVRRALEAPLRQIAENSGVDGSVVAGKIRESDDNAFGFNAQTEEYGDLFKFGVIDPAKVVRTALQDAASVAGLLITTEAMVADKP 525          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_GLUOX (60 kDa chaperonin OS=Gluconobacter oxydans GN=groL PE=3 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 1.309e-65
Identity = 128/244 (52.46%), Postives = 174/244 (71.31%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTGG +I+E++G+ LE V L+MLG  KK+ I K++T I++GAG+   I+ RC QIR+ IE +TSDYD+EKLQERLAKL+GGVAV+++GG++E EV E+KDRV DAL+AT+AAVEEGIVPGGG             +  N DQ++G +I++ AL+ P+  I             K+LE +    G+DA KGEY D+V +GIIDP KV+RTAL DAASV  L+ TTEA+V E P+  K+AP
Sbjct:  290 EDIAILTGGQVISEDIGIKLESVTLEMLGRAKKIHIEKENTTIVEGAGNSDDIKGRCNQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALARASSALKGLTFDNDDQRVGGEIVRKALQAPLRQIAFNAGEDGAVIAGKVLENEGYVFGFDAQKGEYKDLVAAGIIDPTKVVRTALQDAASVGGLLITTEAMVAERPE--KKAP 531          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_RHOS5 (60 kDa chaperonin OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=groL PE=3 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 1.709e-65
Identity = 131/244 (53.69%), Postives = 171/244 (70.08%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            QD+A+LTGG +I+E+LGM LE V +DMLG  KKV+I+KD+T I+DGAG+K  IE R  QIR+ IE +TSDYD+EKLQER+AKL+GGVAV+++GG +E EV E+KDRV DALNAT+AAV+EGIV GGGV            +  N DQ  G+ I++ AL+ P+  I             K+ E D+   G++A   EY DM K G+IDP KV+RTAL DAASV+SL+ TTEA++ + P E K AP
Sbjct:  290 QDIAILTGGQVISEDLGMKLENVTIDMLGRAKKVSINKDNTTIVDGAGEKAEIEARVSQIRTQIEETTSDYDREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALIQAGKVLDGLTGENPDQNAGITIVRRALEAPLRQIAQNAGVDGSVVAGKVRESDDKAFGFNAQTEEYGDMFKFGVIDPAKVVRTALEDAASVASLLITTEAMIADKP-EPKSAP 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_RHOPA (60 kDa chaperonin OS=Rhodopseudomonas palustris GN=groL PE=3 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 1.709e-65
Identity = 131/244 (53.69%), Postives = 171/244 (70.08%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            QD+A+LTGG +I+E+LGM LE V +DMLG  KKV+I+KD+T I+DGAG+K  IE R  QIR+ IE +TSDYD+EKLQER+AKL+GGVAV+++GG +E EV E+KDRV DALNAT+AAV+EGIV GGGV            +  N DQ  G+ I++ AL+ P+  I             K+ E D+   G++A   EY DM K G+IDP KV+RTAL DAASV+SL+ TTEA++ + P E K AP
Sbjct:  290 QDIAILTGGQVISEDLGMKLENVTIDMLGRAKKVSINKDNTTIVDGAGEKAEIEARVSQIRTQIEETTSDYDREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALIQAGKVLDGLTGENPDQNAGITIVRRALEAPLRQIAQNAGVDGSVVAGKVRESDDKAFGFNAQTEEYGDMFKFGVIDPAKVVRTALEDAASVASLLITTEAMIADKP-EPKSAP 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH601_RHIL3 (60 kDa chaperonin 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=groL1 PE=3 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 1.709e-65
Identity = 128/239 (53.56%), Postives = 175/239 (73.22%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+ISK++T I+DG+G K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GG++E EV EKKDR+ DALNAT+AAV+EGIVPGGG+              AN DQ+ G+ I++ AL++ V  I             K+L+++  + GY+A   EY DM+  GI+DPLKV+RTAL +AASV+SL+ TTEA++ ELPK+
Sbjct:  290 EDIAILTGGTVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKTDIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGIALLRSSTKITVKG-ANDDQEAGINIVRRALQSLVRQIAENAGDEASIVVGKVLDKNEDNFGYNAQTSEYGDMIAMGIVDPLKVVRTALQNAASVASLLITTEAMIAELPKK 527          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_GRABC (60 kDa chaperonin OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=groL PE=3 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 2.232e-65
Identity = 128/244 (52.46%), Postives = 174/244 (71.31%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTGG +I+E+LG+ LE V L  LGT K+V I K++T I++GAG    I+ RC QIR+  E +TSDYD+EKLQERLAKL+GGVAV+++GG++E EV E+KDRV DAL+AT+AAVEEGIVPGGGV               N DQK+G++II+ AL++P+  I             K+LE    + G+DA  GE+ D+V +GIIDP KV+RTAL DAASV++L+ TTEA++ E P+  K+AP
Sbjct:  290 EDIAILTGGTVISEDLGIKLETVTLQQLGTAKRVLIEKENTTIVEGAGSPDDIKGRCSQIRAQAEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGVALARASLKLADLGYDNGDQKVGIEIIRRALQSPLRQISENAGEDGAVIAGKVLENGTYNFGFDAQTGEFKDLVSAGIIDPAKVVRTALQDAASVAALLITTEAMIAEKPE--KKAP 531          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_DICNV (60 kDa chaperonin OS=Dichelobacter nodosus (strain VCS1703A) GN=groL PE=3 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 2.232e-65
Identity = 129/239 (53.97%), Postives = 171/239 (71.55%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+EE+G+ LE V LD LGT K+VT+ KD+T I+DG+G+K +IE R   IR  IE S+SDYDKEKLQER+AKL+GGVAV+K+G A+E E+ EKKDRV DAL+AT+AAVEEGIVPGGGV               N+DQ++G+ I + A++ P+ TI             ++      D GYDAA G+YVDMV +GIIDP KV R+AL +AASV+ LM TTEA+V E+P++
Sbjct:  290 EDIAILTGGTVISEEVGLTLESVTLDQLGTAKRVTVGKDNTTIIDGSGEKSAIEARVALIRHQIEESSSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGIVPGGGVALIRAINSIVDLKGDNYDQQVGIDIARRAMEYPLRTIVSNAGSEAAVVLERVKSGKGND-GYDAATGQYVDMVAAGIIDPTKVTRSALQNAASVAGLMITTEAMVSEIPQK 527          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH603_SINMW (60 kDa chaperonin 3 OS=Sinorhizobium medicae (strain WSM419) GN=groL3 PE=3 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 2.232e-65
Identity = 125/239 (52.30%), Postives = 171/239 (71.55%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +++E+LG+ LE V L+MLG  KKV+I K++T I+DGAG K  IE R  QIR+ IE +TSDYD+EKLQERLAKL+GGVAV+++GG++E EV EKKDRV DAL+AT+AAVEEGI+PGGG+             TAN DQ++G++I++ A++ PV  I             KL E+     G++A   EY D+   G+IDP+KV+RTAL DAASV+ L+ TTEA++ E PK+
Sbjct:  290 EDIAILTGGTVVSEDLGIMLENVTLEMLGRAKKVSIEKENTTIIDGAGSKTEIEGRTAQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGIALLRAVNALDGLKTANDDQRVGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKVEFSYGWNAQTNEYGDLYTMGVIDPVKVVRTALQDAASVAGLLVTTEAMIAEKPKK 528          
The following BLAST results are available for this feature:
BLAST of DC900313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH601_RHOP21.002e-6553.0960 kDa chaperonin 1 OS=Rhodopseudomonas palustris ... [more]
CH60_SULSY1.309e-6551.6460 kDa chaperonin OS=Sulfurihydrogenibium sp. (str... [more]
CH60_JANSC1.309e-6554.8560 kDa chaperonin OS=Jannaschia sp. (strain CCS1) ... [more]
CH60_GLUOX1.309e-6552.4660 kDa chaperonin OS=Gluconobacter oxydans GN=groL... [more]
CH60_RHOS51.709e-6553.6960 kDa chaperonin OS=Rhodobacter sphaeroides (stra... [more]
CH60_RHOPA1.709e-6553.6960 kDa chaperonin OS=Rhodopseudomonas palustris GN... [more]
CH601_RHIL31.709e-6553.5660 kDa chaperonin 1 OS=Rhizobium leguminosarum bv.... [more]
CH60_GRABC2.232e-6552.4660 kDa chaperonin OS=Granulibacter bethesdensis (s... [more]
CH60_DICNV2.232e-6553.9760 kDa chaperonin OS=Dichelobacter nodosus (strain... [more]
CH603_SINMW2.232e-6552.3060 kDa chaperonin 3 OS=Sinorhizobium medicae (stra... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900313 VSS Citrus sinensis cDNA clone VS28663 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900313 ID=DC900313|Name=DC900313|organism=Citrus sinensis|type=EST|length=1041bp
GCAGGATCTGGCTGTTCTCACTGGTGGTGATCTGATAACTGAAGAGCTCG
GCATGGACCTTGAGAAAGTGAATCTGGATATGCTCGGCACTTGCAAAAAG
GTTACAATATCGAAGGATGACACTGTCATTCTGGACGGTGCTGGTGATAA
GAAGTCCATTGAAGAAAGATGTGAACAGATTAGGTCTGCGATTGAGAACA
GCACTTCTGATTATGACAAGGAGAAGTTGCAAGAAAGATTGGCAAAGCTT
TCTGGTGGTGTTGCTGTGTTGAAGATTGGAGGAGCTAGTGAAGCTGAAGT
TGGTGAGAAGAAAGATAGAGTTACTGATGCTTTGAATGCGACAAAGGCAG
CTGTAGAAGAGGGTATTGTGCCGGGTGGTGGTGTTGCCCTTCTATATGCG
GCAAAAGAGTTGGAAAAGCTGTCCACTGCTAACTTTGACCAGAAGATTGG
TGTTCAGATTATTCAGAATGCTCTAAAGACACCAGTGCACACAATTGCTG
CTAATGCAGGAGTTGAGGGGGCTGTTGTGGTTGGTAAGCTATTGGAGCAG
GACAACACTGACCTTGGGTATGATGCCGCCAAAGGTGAGTATGTTGATAT
GGTCAAATCTGGAATTATCGATCCATTGAAAGTAATCAGAACTGCTTTGG
TTGATGCTGCAAGTGTATCATCTTTAATGACCACAACTGAAGCTATTGTT
GTTGAGCTGCCTAAGGAGGANAAGGAAGCTCCGGGAGGCATGGGTGGCAT
GGGCGGAATGGGCGGCATGGACTATTGAAATCCCAGTANAATGCTTAACT
GATTGTCCCTTTTTTTTTTTTTTGGGGTTCCATAATCAACATACAATCTG
AATGTTAGGATTTTGTGGCCAGCTTAATNANAAAAAANTGTGTCAATCAT
AAGGCATCCTTGTAATCATAGTGANAGGTAGGCATTTAGGTCGTTTGGCA
ATTTAGGATAAAACATTGCTGATTTAGGTCGTTTGGCAATCCNCTTGGAT
GATTGGTTGGTTTTTAATTGAACTGGATTTTNTTTCCCATT
back to top