DC900296

Overview
NameDC900296
Unique NameDC900296
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length501
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1518 contig Csv1_Contig1518:764..1264. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT1_COFCA (Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.527e-21
Identity = 46/109 (42.20%), Postives = 68/109 (62.39%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP+ D IFMKW+ H++ D+   KLLKNCY+ALPD GK++     + E P  S A++ +  +D ++L   P G+ERT++E+  LA  AGFK     C   N ++ME  K
Sbjct:  242 SVPKGDAIFMKWICHDWSDDHCRKLLKNCYQALPDNGKVILAECVLPEAPDTSLATQNVVHVDVVMLAHNPGGKERTEKEFEALAKGAGFKEFRKVCSAVNTWIMELCK 350          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: IEMT_CLABR ((Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 2.605e-21
Identity = 48/110 (43.64%), Postives = 69/110 (62.73%), Query Frame = 2
Query:    2 ENVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            + VP+ D IF+KW+ H++ DE  LKLLKNCY ALPD GK++     +   P  S A++ +   D ++L   P G+ERT++E+  LA+ +GF+G        N YVMEFLK
Sbjct:  257 DGVPKGDAIFIKWICHDWSDEHCLKLLKNCYAALPDHGKVIVAEYILPPSPDPSIATKVVIHTDALMLAYNPGGKERTEKEFQALAMASGFRGFKVASCAFNTYVMEFLK 366          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT1_OCIBA (Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 3.402e-21
Identity = 46/109 (42.20%), Postives = 67/109 (61.47%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP+ D IFMKW+ H++ DE  +K LKNCY ALP  GK++     + E P    A++ +  +D I+L   P G+ERT++E+  LA  AGFK  +  C   N ++ME LK
Sbjct:  253 SVPKGDAIFMKWICHDWSDEHCVKFLKNCYDALPQNGKVILAECVLPEAPDTGLATKNVVHIDVIMLAHNPGGKERTEKEFQGLAKAAGFKQFNKACCAYNTWIMELLK 361          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: OMT1_ARATH (Quercetin 3-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 5.802e-21
Identity = 43/109 (39.45%), Postives = 72/109 (66.06%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP+ D IFMKW+ H++ DE  +K LKNCY++LP+ GK++     + E P +S +++++  +D I+L   P G+ERT++E+  LA  +GFKG+   C    + ++E LK
Sbjct:  253 SVPKGDAIFMKWICHDWSDEHCVKFLKNCYESLPEDGKVILAECILPETPDSSLSTKQVVHVDCIMLAHNPGGKERTEKEFEALAKASGFKGIKVVCDAFGVNLIELLK 361          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT1_POPTM (Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 5.802e-21
Identity = 46/109 (42.20%), Postives = 69/109 (63.30%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP+AD +FMKW+ H++ D   LK LKNCY ALP+ GK++ +   +   P  S A++ +  +D I+L   P G+ERT++E+  LA  AGF+G    C   N +V+EF K
Sbjct:  255 SVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHVDVIMLAHNPGGKERTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK 363          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT1_POPKI (Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 7.578e-21
Identity = 46/109 (42.20%), Postives = 68/109 (62.39%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP AD +FMKW+ H++ D   LK LKNCY ALP+ GK++ +   +   P  S A++ +  +D I+L   P G+ERT++E+  LA  AGF+G    C   N +V+EF K
Sbjct:  255 SVPNADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHVDVIMLAHNPGGKERTEKEFEGLANGAGFQGFEVMCCAFNTHVIEFRK 363          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT1_EUCGU (Caffeic acid 3-O-methyltransferase OS=Eucalyptus gunnii GN=OMT PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 3.761e-20
Identity = 46/109 (42.20%), Postives = 67/109 (61.47%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP+ D IFMKW+ H++ D+   K LKNCY ALP+ GK++     +   P  S A++ +  +D I+L   P G+ERT++E+  LA  AGF+G    C     +VMEFLK
Sbjct:  256 SVPKGDAIFMKWICHDWSDDHCAKFLKNCYDALPNIGKVIVAECVLPVYPDTSLATKNVIHIDCIMLAHNPGGKERTQKEFETLAKGAGFQGFQVMCCAFGTHVMEFLK 364          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT1_CATRO (Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 8.379e-20
Identity = 44/109 (40.37%), Postives = 69/109 (63.30%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP+ D IFMKW+ H++ D   LK LKNC++ALP+ GK++     + E P ++ +++    +D I+L   P G+ERT++E+  LA  AGF+G    C   N ++ME LK
Sbjct:  255 SVPKGDAIFMKWICHDWSDAHCLKFLKNCHEALPENGKVILAECLLPEAPDSTLSTQNTVHVDVIMLAHNPGGKERTEKEFEALAKGAGFRGFIKVCCAYNSWIMELLK 363          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT2_OCIBA (Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.094e-19
Identity = 43/109 (39.45%), Postives = 67/109 (61.47%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP+ D IFMKW+ H++ D   +K LK CY+ALP+ GK++     + E P    A++ +  +D I+L   P G+ERT++E+  LA  +GFK  +  C   N ++ME LK
Sbjct:  253 SVPKGDAIFMKWICHDWSDAHCVKFLKKCYEALPENGKVILAECVLPEAPDTGLATKNVVHIDVIMLAHNPGGKERTEKEFQVLAKASGFKQFNKVCCAYNSWIMELLK 361          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: IMT1_MESCR (Inositol 4-methyltransferase OS=Mesembryanthemum crystallinum GN=IMT1 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.867e-19
Identity = 43/110 (39.09%), Postives = 69/110 (62.73%), Query Frame = 2
Query:    2 ENVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            E++P+AD IFMKW+LH++ DE  +K+L  CY++L  GGK++ + S I  +P+++  S  +  LD   L+    G+ER+K+++  LA K GF  V   C   + +VME  K
Sbjct:  255 ESIPQADAIFMKWVLHDWSDEHCVKILNKCYESLAKGGKIILVESLIPVIPEDNLESHMVFSLDCHTLVHNQGGKERSKEDFEALASKTGFSTVDVICCAYDTWVMELYK 364          
The following BLAST results are available for this feature:
BLAST of DC900296 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
COMT1_COFCA1.527e-2142.20Caffeic acid 3-O-methyltransferase OS=Coffea canep... [more]
IEMT_CLABR2.605e-2143.64(Iso)eugenol O-methyltransferase OS=Clarkia brewer... [more]
COMT1_OCIBA3.402e-2142.20Caffeic acid 3-O-methyltransferase 1 OS=Ocimum bas... [more]
OMT1_ARATH5.802e-2139.45Quercetin 3-O-methyltransferase 1 OS=Arabidopsis t... [more]
COMT1_POPTM5.802e-2142.20Caffeic acid 3-O-methyltransferase 1 OS=Populus tr... [more]
COMT1_POPKI7.578e-2142.20Caffeic acid 3-O-methyltransferase 1 OS=Populus ki... [more]
COMT1_EUCGU3.761e-2042.20Caffeic acid 3-O-methyltransferase OS=Eucalyptus g... [more]
COMT1_CATRO8.379e-2040.37Caffeic acid 3-O-methyltransferase OS=Catharanthus... [more]
COMT2_OCIBA1.094e-1939.45Caffeic acid 3-O-methyltransferase 2 OS=Ocimum bas... [more]
IMT1_MESCR1.867e-1939.09Inositol 4-methyltransferase OS=Mesembryanthemum c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900296 VSS Citrus sinensis cDNA clone VS28643 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900296 ID=DC900296|Name=DC900296|organism=Citrus sinensis|type=EST|length=501bp
CGAAAATGTTCCTGAGGCGGATACCATTTTCATGAAGTGGATGCTTCACA
ATTTTGATGATGAGCAAACTTTGAAATTGTTGAAGAATTGTTACAAAGCT
CTTCCAGATGGTGGGAAGCTGCTCAATATTAATTCAACAATTTCAGAAGT
GCCTCAAAATAGTGCGGCTTCAAGGGAAATCTCTATTTTGGATACAATTT
TGTTGATCCAAATTCCTCATGGAAGAGAGCGCACCAAACAAGAATACAAT
GAATTGGCAATTAAAGCTGGATTTAAAGGTGTCAGCTACGAATGTGGTGT
ATGTAATTTATATGTTATGGAGTTCTTGAAATAGATTGCTTTTTTCTCTA
TTCGGAAAGATCTCCTTAGCTTTCTTGGGTTGTTTTCAATTTCCGGTTTG
TCTTGTTATCTCTTTCCTTTGGATTGAGGGCTTCTCTTATGTAATCTCTT
TCGTTTTATCAATAATAAATCTCTTATAGGGAGATTGATTCCCGTATAAG
G
back to top