DC900296

Overview
NameDC900296
Unique NameDC900296
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length501
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1518 contig Csv1_Contig1518:764..1264. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT1_CAPCH (Caffeic acid 3-O-methyltransferase OS=Capsicum chinense GN=COMT PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.064e-18
Identity = 45/109 (41.28%), Postives = 67/109 (61.47%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP+AD IFMKW+ H++ D+  +KLLKNCY+ALP  GK++ +   + E P  SAA++     D I+L   P G+ERT++++  LA    F      C   + +VMEF K
Sbjct:  251 SVPKADAIFMKWICHDWSDDHCIKLLKNCYEALPANGKVIIVECILPEAPDTSAATKSKVHGDIIMLAHNPGGKERTEKDFEALANWGWFSRFRKVCCAYHTWVMEFNK 359          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: SMT_COPJA ((S)-scoulerine 9-O-methyltransferase OS=Coptis japonica GN=SMT PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 8.670e-17
Identity = 44/110 (40.00%), Postives = 68/110 (61.82%), Query Frame = 2
Query:    2 ENVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            E VP A  I +KW+LH++DD++++K+LKNC+KALP+ G ++ I   + +V  N+A S      D +++   P G+ERT  E++ LA  AGF    +      L+VMEF K
Sbjct:  269 EGVPNAQNILLKWVLHDWDDDRSIKILKNCWKALPENGTVIVIEFVLPQVLGNNAESFNALTPDLLMMALNPGGKERTTIEFDGLAKAAGFAETKFFPISQGLHVMEFHK 378          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: OMT1_ORYSJ (Quercetin 3-O-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=ROMT-9 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 5.620e-16
Identity = 41/104 (39.42%), Postives = 61/104 (58.65%), Query Frame = 2
Query:   20 DTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            D I MKW+LH++ DE   +LLKNCY ALP+ GK++ +   + E    +A  + +  +D I+L   P G+ER ++E+ ELA  AGF G        N + +EF K
Sbjct:  265 DAILMKWILHDWSDEHCARLLKNCYDALPEHGKVVVVECVLPESSDATAREQGVFHVDMIMLAHNPGGKERYEREFRELARAAGFTGFKATYIYANAWAIEFTK 368          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT1_MAIZE (Caffeic acid 3-O-methyltransferase OS=Zea mays PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 9.586e-16
Identity = 40/109 (36.70%), Postives = 63/109 (57.80%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP  D I MKW+LH++ D     LLKNCY ALP+ GK++ +   +    + +  ++ +  +D I+L   P G+ER ++E+ ELA  AGF G        N + +EF+K
Sbjct:  256 SVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDMIMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK 364          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT1_SACOF (Caffeic acid 3-O-methyltransferase OS=Saccharum officinarum GN=COMT PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.252e-15
Identity = 40/110 (36.36%), Postives = 64/110 (58.18%), Query Frame = 2
Query:    2 ENVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            ++VP  D I MKW+LH++ D     LLKNCY ALP+ GK++ +   +    +    ++ +  +D I+L   P GRER ++E+++LA  AGF G        N + +EF+K
Sbjct:  253 KSVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIIVECVLPVNTEAVPKAQGVFHVDMIMLAHNPGGRERYEREFHDLAKGAGFSGFKATYIYANAWAIEFIK 362          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: CHOMT_MEDSA (Isoliquiritigenin 2'-O-methyltransferase OS=Medicago sativa PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 8.115e-15
Identity = 41/110 (37.27%), Postives = 66/110 (60.00%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCN-LYVMEFLK 331
            +VP+ D + +K + HN+ DE+ ++ L NC+KAL   GK++ +   + E P  S  S+ +S LD ++ I +  GRERT+++Y +L+  +GF      C   N L VMEF K
Sbjct:  264 SVPQGDAMILKAVCHNWSDEKCIEFLSNCHKALSPNGKVIIVEFILPEEPNTSEESKLVSTLDNLMFITV-GGRERTEKQYEKLSKLSGFSKFQVACRAFNSLGVMEFYK 372          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT1_EUCGL (Caffeic acid 3-O-methyltransferase (Fragment) OS=Eucalyptus globulus GN=COMT1 PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 4.923e-12
Identity = 30/77 (38.96%), Postives = 46/77 (59.74%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERT 235
            N+P  D +FMKW+ H++ DE   KLLKNCY ALP  G+++     +   P  S +++ +  +D I+L     G+ERT
Sbjct:  237 NIPNGDAVFMKWICHDWSDEHCAKLLKNCYDALPVNGRVIVAEYILPAYPDQSLSTKGVIHMDCIMLTHFSGGKERT 313          
The following BLAST results are available for this feature:
BLAST of DC900296 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
COMT1_CAPCH2.064e-1841.28Caffeic acid 3-O-methyltransferase OS=Capsicum chi... [more]
SMT_COPJA8.670e-1740.00(S)-scoulerine 9-O-methyltransferase OS=Coptis jap... [more]
OMT1_ORYSJ5.620e-1639.42Quercetin 3-O-methyltransferase 1 OS=Oryza sativa ... [more]
COMT1_MAIZE9.586e-1636.70Caffeic acid 3-O-methyltransferase OS=Zea mays PE=... [more]
COMT1_SACOF1.252e-1536.36Caffeic acid 3-O-methyltransferase OS=Saccharum of... [more]
CHOMT_MEDSA8.115e-1537.27Isoliquiritigenin 2'-O-methyltransferase OS=Medica... [more]
COMT1_EUCGL4.923e-1238.96Caffeic acid 3-O-methyltransferase (Fragment) OS=E... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900296 VSS Citrus sinensis cDNA clone VS28643 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900296 ID=DC900296|Name=DC900296|organism=Citrus sinensis|type=EST|length=501bp
CGAAAATGTTCCTGAGGCGGATACCATTTTCATGAAGTGGATGCTTCACA
ATTTTGATGATGAGCAAACTTTGAAATTGTTGAAGAATTGTTACAAAGCT
CTTCCAGATGGTGGGAAGCTGCTCAATATTAATTCAACAATTTCAGAAGT
GCCTCAAAATAGTGCGGCTTCAAGGGAAATCTCTATTTTGGATACAATTT
TGTTGATCCAAATTCCTCATGGAAGAGAGCGCACCAAACAAGAATACAAT
GAATTGGCAATTAAAGCTGGATTTAAAGGTGTCAGCTACGAATGTGGTGT
ATGTAATTTATATGTTATGGAGTTCTTGAAATAGATTGCTTTTTTCTCTA
TTCGGAAAGATCTCCTTAGCTTTCTTGGGTTGTTTTCAATTTCCGGTTTG
TCTTGTTATCTCTTTCCTTTGGATTGAGGGCTTCTCTTATGTAATCTCTT
TCGTTTTATCAATAATAAATCTCTTATAGGGAGATTGATTCCCGTATAAG
G
back to top