DC900291

Overview
NameDC900291
Unique NameDC900291
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length991
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900291_ssr1 microsatellite DC900291_ssr1:1..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig906 contig Csv1_Contig906:136..1126. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL1_ARATH (Probable 6-phosphogluconolactonase 1 OS=Arabidopsis thaliana GN=At1g13700 PE=2 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 1.039e-64
Identity = 122/249 (49.00%), Postives = 171/249 (68.67%), Query Frame = 1
Query:   88 VQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGN---NQNSDLLPVQMA-LAEEEFTWFLDKXATSKL 822
            ++V ++ E+L++ L  Y A++S    KE G+F +VLSGGSLI  + KL+EPPY   ++WAKW+VFW DERVV K+HDDSNYKLA D  LS+V +   ++ +IND +SAE AA +YE  ++ + +S  +A S  +  P+FDL+LLGMG DGH+ASLFP HP L+  + WVTF+ DS KPPPERITFT PVINS+A + +V  G  K++A+  A+ +     +S  LP ++   +     WF+DK A SKL
Sbjct:   13 IRVHENLEELSIDLVDYIAEISEASIKEHGAFCIVLSGGSLISFMGKLIEPPYDKIVDWAKWYVFWADERVVAKNHDDSNYKLAKDNLLSKVNVFPRHICSINDTVSAEEAATEYEFAIRQMVRSRTVAASDNSDSPRFDLILLGMGSDGHVASLFPNHPALEVKDDWVTFLTDSHKPPPERITFTLPVINSAANVVVVATGESKANAIHLAIDDLPLPDSSLSLPARLVHPSNGNLIWFMDKQAGSKL 261          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL1_ORYSJ (Probable 6-phosphogluconolactonase 1 OS=Oryza sativa subsp. japonica GN=Os03g0416500 PE=2 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 3.344e-63
Identity = 119/260 (45.77%), Postives = 170/260 (65.38%), Query Frame = 1
Query:   55 MAAENKNKNKNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGN---NQNSDLLPVQMAL-AEEEFTWFLDKXATSKL 822
            +A+    KN  +++F+S +++A  LA+Y + +S    KE+G F + LSGG LI  +RKL E PY  +++W+KW++FW DER V K+H DS YK   + FLS+VPI  G+VY+IND ++ E AA DYE  ++ L K   +  S +   PKFDL+LL +G DGH+ASLFP HP L+  + WVT+I DSP PPPERITFT PVINS++ IA+V  G  K+ AV  A+ +     ++  +P +M    + +  WFLDK + S L
Sbjct:   23 VASYEPKKNNEIRMFESSDEMATDLAEYISQVSEISIKERGYFAIALSGGPLISFMRKLCEAPYNKTLDWSKWYIFWADERAVAKNHVDSYYKSTKEDFLSKVPILNGHVYSINDNVTVEDAATDYEFVIRQLVKIRTVGVSESNDCPKFDLILLSIGSDGHVASLFPNHPALELKDDWVTYITDSPVPPPERITFTLPVINSASNIAVVATGEDKAKAVYFAISDGTEGPDAPSIPARMVQPTDGKLVWFLDKASASFL 282          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL1_ORYSI (Probable 6-phosphogluconolactonase 1 OS=Oryza sativa subsp. indica GN=OsI_011697 PE=3 SV=2)

HSP 1 Score: 242.276 bits (617), Expect = 3.344e-63
Identity = 119/260 (45.77%), Postives = 170/260 (65.38%), Query Frame = 1
Query:   55 MAAENKNKNKNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGN---NQNSDLLPVQMAL-AEEEFTWFLDKXATSKL 822
            +A+    KN  +++F+S +++A  LA+Y + +S    KE+G F + LSGG LI  +RKL E PY  +++W+KW++FW DER V K+H DS YK   + FLS+VPI  G+VY+IND ++ E AA DYE  ++ L K   +  S +   PKFDL+LL +G DGH+ASLFP HP L+  + WVT+I DSP PPPERITFT PVINS++ IA+V  G  K+ AV  A+ +     ++  +P +M    + +  WFLDK + S L
Sbjct:   23 VASYEPKKNNEIRMFESSDEMATDLAEYISQVSEISIKERGYFAIALSGGPLISFMRKLCEAPYNKTLDWSKWYIFWADERAVAKNHVDSYYKSTKEDFLSKVPILNGHVYSINDNVTVEDAATDYEFVIRQLVKIRTVGVSESNDCPKFDLILLSIGSDGHVASLFPNHPALELKDDWVTYITDSPVPPPERITFTLPVINSASNIAVVATGEDKAKAVYFAISDGAEGPDAPSIPARMVQPTDGKLVWFLDKASASFL 282          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_RAT (6-phosphogluconolactonase OS=Rattus norvegicus GN=Pgls PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 1.157e-39
Identity = 97/248 (39.11%), Postives = 138/248 (55.65%), Query Frame = 1
Query:   88 VQVFDSEEDLAVSLAKYTADLSAK-FGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDS--IEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKXATSKL 822
            + VF S ++L  SLA+  A  +A      +G F + LSGGSL+  L + +      +    +A+W + + DER+VP DH +S Y L     LS++PI    V  I+ AL  E AAEDY   L+   + + +        P FDL++LG+GPDGH  SLFPGHPLL+E EK V  I DSPKPPP+R+T T PV+N++  +  V  G GK++ ++  L  +Q S L    +        WFLD+ A   L
Sbjct:    9 ISVFSSPQELGASLAQLVAQRAASCLEGNRGRFALGLSGGSLVSMLARDLPAATAPAGPASFARWTLGFCDERLVPFDHAESTYGLYRTHLLSKLPIPDSQVLTIDPALPVEDAAEDYARKLRQAFQGDTV--------PVFDLLILGVGPDGHTCSLFPGHPLLQEREKIVAPIGDSPKPPPQRVTLTLPVLNAAQSVIFVATGEGKAAVLKRIL-EDQESALPAAMVQPRTGALCWFLDEAAARLL 247          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_MOUSE (6-phosphogluconolactonase OS=Mus musculus GN=Pgls PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 1.157e-39
Identity = 97/249 (38.96%), Postives = 139/249 (55.82%), Query Frame = 1
Query:   88 VQVFDSEEDLAVSLAKYTADLSAK-FGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDS--IEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEE-EFTWFLDKXATSKL 822
            + VF S ++L  SLA+  A  +A     ++G F + LSGGSL+  L + +      +    +A+W + + DER+VP DH +S Y L     LS++PI    V  IN AL  E AAEDY   L+   + + +        P FDL++LG+GPDGH  SLFP HPLL+E EK V  I DSPKPPP+R+T T PV+N++  I  V  G GK++ ++  L + + +  LP  +         WFLD+ A   L
Sbjct:    9 ISVFSSPQELGASLAQLVAQRAASCLEGDRGRFALGLSGGSLVSMLARDLPAAAAPAGPASFARWTLGFCDERLVPFDHAESTYGLYRTHLLSKLPIPDSQVLTINPALPVEDAAEDYARKLRQALQGDAV--------PVFDLLILGVGPDGHTCSLFPDHPLLQEREKIVAPISDSPKPPPQRVTLTLPVLNAAQSIIFVATGEGKAAVLKRILEDKEGT--LPAALVQPRTGALCWFLDEAAARLL 247          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_BOVIN (6-phosphogluconolactonase OS=Bos taurus GN=PGLS PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 7.501e-39
Identity = 94/248 (37.90%), Postives = 139/248 (56.05%), Query Frame = 1
Query:   88 VQVFDSEEDLAVSLAKYTADLSAKFGKEKGS-FTVVLSGGSLIDSLRKLVEPPYVDS--IEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKXATSKL 822
            + VF S ++L  SLA+     +A    + G+ FT+ LSGGSL+  L + +      +     A+W + + DER+VP +H +S Y L     LS++PI    V  IN AL  E AAEDY   L+   + + +        P FDL++LG+GPDGH  SLFP HPLL+E EK V  I DSPKPPP+R+T T PV+N++  +  V  G GK++ ++  L + + + L    +  +  +  WFLD+ A   L
Sbjct:    9 ISVFSSPQELGASLAQLVVQQAACCLADAGARFTLGLSGGSLVSMLARELPAAAAPAGPASLARWTLGFCDERLVPFEHAESTYGLYRTHLLSKLPIFDSQVITINPALPVEEAAEDYAKKLRQAFQGDSI--------PVFDLLILGVGPDGHTCSLFPDHPLLQEREKIVAPISDSPKPPPQRVTLTLPVLNAARTVIYVATGEGKAAILKRILEDKEENPLPAALVQPSAGKLCWFLDEAAARLL 248          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_HUMAN (6-phosphogluconolactonase OS=Homo sapiens GN=PGLS PE=1 SV=2)

HSP 1 Score: 159.458 bits (402), Expect = 2.850e-38
Identity = 95/250 (38.00%), Postives = 137/250 (54.80%), Query Frame = 1
Query:   88 VQVFDSEEDLAVSLAKYTADLSAK-FGKEKGSFTVVLSGGSLIDSLRK----LVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKXATSKL 822
            + VF S ++L  +LA+  A  +A      +  F + LSGGSL+  L +     V P    S+  A+W + + DER+VP DH +S Y L     LS++PI    V  IN  L  E AAEDY   L+   + + +        P FDL++LG+GPDGH  SLFP HPLL+E EK V  I DSPKPPP+R+T T PV+N++  +  V  G GK++ ++  L + + + L    +     +  WFLD+ A   L
Sbjct:    9 ISVFSSSQELGAALAQLVAQRAACCLAGARARFALGLSGGSLVSMLARELPAAVAPAGPASL--ARWTLGFCDERLVPFDHAESTYGLYRTHLLSRLPIPESQVITINPELPVEEAAEDYAKKLRQAFQGDSI--------PVFDLLILGVGPDGHTCSLFPDHPLLQEREKIVAPISDSPKPPPQRVTLTLPVLNAARTVIFVATGEGKAAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLL 248          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_MYCTU (6-phosphogluconolactonase OS=Mycobacterium tuberculosis GN=pgl PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 7.265e-34
Identity = 89/250 (35.60%), Postives = 129/250 (51.60%), Query Frame = 1
Query:   79 NKNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATG--FPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKXATSKL 822
            + ++++F   + L  +  K            +G   +VL+GG    +L + +       IEW+K H+FW DER VP+D D+ N K A    L+ V I +  V+ +  A S      D +     L    +LA SAA G   P FD+ LLGMGP+GHI SLFP  P + E+ + V  + DSPKPPP RIT T P I  S  + ++V G GK+ AV  A+G   +   +P   A+  +   W LD+ A +KL
Sbjct:    2 SSSIEIFPDSDILVAAAGKRLVGAIGAAVAARGQALIVLTGGGNGIALLRYLSAQ-AQQIEWSKVHLFWGDERYVPEDDDERNLKQARRALLNHVDIPSNQVHPM--AASDGDFGGDLDAAA--LAYEQVLAASAAPGDPAPNFDVHLLGMGPEGHINSLFPHSPAVLESTRMVVAVDDSPKPPPRRITLTLPAIQRSREVWLLVSGPGKADAVAAAIG-GADPVSVPAAGAVGRQNTLWLLDRDAAAKL 245          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_MYCBO (6-phosphogluconolactonase OS=Mycobacterium bovis GN=pgl PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 7.265e-34
Identity = 89/250 (35.60%), Postives = 129/250 (51.60%), Query Frame = 1
Query:   79 NKNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATG--FPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKXATSKL 822
            + ++++F   + L  +  K            +G   +VL+GG    +L + +       IEW+K H+FW DER VP+D D+ N K A    L+ V I +  V+ +  A S      D +     L    +LA SAA G   P FD+ LLGMGP+GHI SLFP  P + E+ + V  + DSPKPPP RIT T P I  S  + ++V G GK+ AV  A+G   +   +P   A+  +   W LD+ A +KL
Sbjct:    2 SSSIEIFPDSDILVAAAGKRLVGAIGAAVAARGQALIVLTGGGNGIALLRYLSAQ-AQQIEWSKVHLFWGDERYVPEDDDERNLKQARRALLNHVDIPSNQVHPM--AASDGDFGGDLDAAA--LAYEQVLAASAAPGDPAPNFDVHLLGMGPEGHINSLFPHSPAVLESTRMVVAVDDSPKPPPRRITLTLPAIQRSREVWLLVSGPGKADAVAAAIG-GADPVSVPAAGAVGRQNTLWLLDRDAAAKL 245          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_SCHPO (Probable 6-phosphogluconolactonase OS=Schizosaccharomyces pombe GN=SPCC16C4.10 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 6.150e-33
Identity = 94/258 (36.43%), Postives = 131/258 (50.78%), Query Frame = 1
Query:   85 NVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNY----KLAYDGFLSQVPITTGNVYAINDALSAEG------AAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEE--EFTWFLDKXATSKL 822
            +V  F     +A +L  +  + S    K  G FT+ LSGGSL   L + +       IE++KW VF+ DER+VP D ++SNY    KL +D F    P     ++ IN  L  E        A++YE  L H     + A S+    P FDL+LLG GPDGH  SLFP H +L+E+  WV  + DSPKPP +RIT T PV+  +  IA V  GAGK   +   +     +  LP  +         +WF+D  A++ L
Sbjct:    2 SVYSFSDVSLVAKALGAFVKEKSEASIKRHGVFTLALSGGSLPKVLAEGLAQQR--GIEFSKWEVFFADERIVPLDDENSNYALCKKLIFDKFEGFDP---KKIHTINPELLKENPIDPQNVADEYEKQLVH-----VFANSSTVKVPVFDLLLLGCGPDGHTCSLFPDHEVLQEDVAWVAPVTDSPKPPKDRITLTLPVVTHAQAIAFVTTGAGKKDILPIVI--EDFTSKLPSALITRNNLTRTSWFVDDEASANL 247          
The following BLAST results are available for this feature:
BLAST of DC900291 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 46
Match NameE-valueIdentityDescription
6PGL1_ARATH1.039e-6449.00Probable 6-phosphogluconolactonase 1 OS=Arabidopsi... [more]
6PGL1_ORYSJ3.344e-6345.77Probable 6-phosphogluconolactonase 1 OS=Oryza sati... [more]
6PGL1_ORYSI3.344e-6345.77Probable 6-phosphogluconolactonase 1 OS=Oryza sati... [more]
6PGL_RAT1.157e-3939.116-phosphogluconolactonase OS=Rattus norvegicus GN=... [more]
6PGL_MOUSE1.157e-3938.966-phosphogluconolactonase OS=Mus musculus GN=Pgls ... [more]
6PGL_BOVIN7.501e-3937.906-phosphogluconolactonase OS=Bos taurus GN=PGLS PE... [more]
6PGL_HUMAN2.850e-3838.006-phosphogluconolactonase OS=Homo sapiens GN=PGLS ... [more]
6PGL_MYCTU7.265e-3435.606-phosphogluconolactonase OS=Mycobacterium tubercu... [more]
6PGL_MYCBO7.265e-3435.606-phosphogluconolactonase OS=Mycobacterium bovis G... [more]
6PGL_SCHPO6.150e-3336.43Probable 6-phosphogluconolactonase OS=Schizosaccha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900291 VSS Citrus sinensis cDNA clone VS28637 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900291 ID=DC900291|Name=DC900291|organism=Citrus sinensis|type=EST|length=991bp
GAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGACAAGGCATCATC
ATCAATGGCTGCCGAGAATAAGAACAAGAACAAGAACGTACAAGTTTTTG
ACTCAGAGGAAGATCTGGCTGTGTCTTTGGCCAAATACACCGCCGATCTA
TCTGCCAAGTTCGGTAAAGAGAAGGGCTCCTTCACTGTCGTCTTATCCGG
TGGTTCTCTCATCGACTCCCTCAGGAAATTAGTGGAACCCCCGTATGTAG
ATTCAATTGAATGGGCGAAATGGCATGTGTTTTGGGTTGATGAAAGAGTT
GTTCCCAAGGATCATGATGATAGCAATTATAAGCTTGCTTATGATGGTTT
CCTTTCTCAGGTACCAATTACCACTGGCAATGTCTATGCCATCAATGATG
CATTATCTGCTGAAGGTGCAGCTGAAGATTACGAGACTTGTCTCAAGCAT
TTGACAAAGAGCAATATATTAGCTACATCTGCTGCTACTGGTTTTCCAAA
GTTTGATCTCATGCTTCTGGGTATGGGTCCAGATGGACATATAGCTTCTC
TGTTTCCAGGGCATCCTCTTCTCAAGGAGAATGAGAAATGGGTTACTTTC
ATTAAAGACTCGCCAAAGCCACCTCCAGAGAGAATCACTTTCACCTTCCC
TGTAATCAACTCATCTGCATATATTGCAATGGTGGTGTGTGGTGCTGGAA
AATCAAGTGCAGTTCAAACTGCATTGGGTAATAATCAAAACTCTGATTTG
CTGCCAGTTCAAATGGCATTGGCTGAAGAAGAATTCACTTGGTTTCTTGA
CAAANACGCGACTTCAAAGCTGTAAGAGTCAGAACAATTTGCTGTATGCA
TGAATCCCTGTTATCTGCTATGATAATTGGTTTGATCTGTGTGGTTTGAC
TACTAGTACTGCTGGATTTTGTTAGTAATGAGAACAGAGTGAACTTGTTA
ATGCAAGTGAAAAAGATTTGAATAAATATAGTTTGATATTT
back to top