DC900291

Overview
NameDC900291
Unique NameDC900291
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length991
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900291_ssr1 microsatellite DC900291_ssr1:1..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig906 contig Csv1_Contig906:136..1126. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: SOL2_YEAST (6-phosphogluconolactonase-like protein 2 OS=Saccharomyces cerevisiae GN=SOL2 PE=1 SV=2)

HSP 1 Score: 110.153 bits (274), Expect = 1.983e-23
Identity = 78/226 (34.51%), Postives = 113/226 (50.00%), Query Frame = 1
Query:  151 SAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPIT---TGNVYAINDALSAEGAAEDYETCLKHLTKSNI--LATSAATGFPKFDLMLLGMGPDGHIASLFPG-HPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKXA 810
            S+K  KEK  F + LSGGSLI+ L + +     D + W  W +++ DER+VP   ++SNY  A    L  +      T  VY I+++L      +D + C  +  K  I   A   +   P FDL LLG  PDGHIASLFP     L+E   WV  ++++P  P  RI+ T PVI  S  +  VV GA K+  ++T +   +      +    A    +WF+D  A
Sbjct:   79 SSKPKKEK-RFKIALSGGSLIEVLHEGLLKR--DDVRWGDWDIYFADERLVPFSSNESNYGCAKRKILDLIDTAKYGTPKVYHIDESL-----IDDPQECADNYEKVLIRGFAGRDSVKLPMFDLFLLGCAPDGHIASLFPNFQDNLREKLAWVVPVENAPSGPSTRISLTIPVICHSHRVTFVVEGATKAPIIKTIMERPEKGLPSSIVNEGAAGRVSWFVDDDA 296          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_CAEEL (Putative 6-phosphogluconolactonase OS=Caenorhabditis elegans GN=Y57G11C.3 PE=2 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 7.536e-23
Identity = 73/253 (28.85%), Postives = 119/253 (47.04%), Query Frame = 1
Query:   67 NKNKNKNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEG-AAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEK--WVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKXATS 816
            N N    + V   E++L + L +Y  +       + G+ ++ +SGGS+     K +     + + W +  +F VDER V  D ++SN       +L   P    +V+            A+ YE  L+       L  +A     +FD++ LG+GPDGH AS+FPG   L++  +  WV+ I DSPKPPP RIT T   +  +  +A ++CG  K+  V+     +Q       Q     ++ T FLD+ A +
Sbjct:   10 NSNMKPALNVSGDEKELILQLRRYLEEKLTYLLDQNGTVSIGVSGGSMPRVFSKAILSLPQEQLNWKRIRIFMVDERNVDLDSEESNQ----GEYLRLFPNELRDVFVPMQIFKDPCLTAQHYEISLRKYLLPEQLNNTA-----RFDILFLGVGPDGHTASIFPGKERLEKITELNWVSVITDSPKPPPSRITLTLQTLQHAKNVAFIICGKQKAEIVRGICDRDQKYP--AAQARPFNDKLTLFLDEDAAT 251          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_THEMA (6-phosphogluconolactonase OS=Thermotoga maritima GN=pgl PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 3.740e-22
Identity = 72/217 (33.18%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  157 KFGKEKGSFTVVLSGGSL-IDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDK 804
            K  +EK    VVL+GG   +    KL E  +     W + H F  DER VP D D SN++   +   S+  I +GNV+ ++ +L  E A E YE  ++  T              +FDL +LGMGPDGH+AS+F      K+N   VTF   S  P   R+T TF  +N+S Y+  ++ G  K + +   L +      LP      +E+  WF+ K
Sbjct:   27 KLLEEKDKIFVVLAGGRTPLPVYEKLAEQKF----PWNRIHFFLSDERYVPLDSDQSNFRNINEVLFSRAKIPSGNVHYVDTSLPIEKACEKYEREIRSAT-------------DQFDLAILGMGPDGHVASIFDLETGNKDN--LVTFTDPSGDPKVPRVTLTFRALNTSLYVLFLIRGKEKINRLTEILKDTP----LPAYFVRGKEKTVWFVGK 220          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: SOL4_YEAST (6-phosphogluconolactonase 4 OS=Saccharomyces cerevisiae GN=SOL4 PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 8.332e-22
Identity = 85/263 (32.32%), Postives = 131/263 (49.81%), Query Frame = 1
Query:   88 VQVFDSEEDLAVSLAKYTADL--SAKFGKEKGSFTVVLSGGSLIDSL-RKLVEPPYV-DSIEWAKWHVFWVDERVVPKDHDDSNY----KLAYDGFLSQV-PITTG-NVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFP-KFDLMLLGMGPDGHIASLFPG---HPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQM-ALAEEEFTWFLDKXATSKL*ES 831
            +Q F  ++ L     K+  +   SA  G     F + +SGGS+  +L   LV    +   I+W +W +F+ DER+VP +   SNY    K   D  + Q   +  G  VY IN++L   G            T +  +A   A+  P  FDL+LLG G DGH  SLFPG   + L++E ++ V +  +SPK P +RITFT  V+  +  +  +V GA K + +   L   +NS+L  V +  +   + TWFLD  A + + E+
Sbjct:    4 LQRFSEKKSLIHEFGKFILEKQESALTGDADAVFNIAISGGSMNQALYESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLVHQGNQLNLGPTVYTINESLIGGGE-----------TANRKIAEEYASMLPASFDLILLGCGEDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAKSVCFLVRGAAKKAIMHDVL-IVKNSELPSVLVNEMVGTKVTWFLDDEAGALIPEN 254          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_PSEPU (6-phosphogluconolactonase OS=Pseudomonas putida GN=pgl PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 5.589e-18
Identity = 72/217 (33.18%), Postives = 103/217 (47.47%), Query Frame = 1
Query:  115 LAVSLAKYTADLSAKFGKEKGSFTVVLSGG-SLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKD----SPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDL 750
            LA +LA   A+        KG   VVLSGG S +  L KL   P    ++WAK  V   DER VP +H DSN  L     L+        V     A + + AA              + A  A TG P  D+++LGMG DGH ASLFP  P L+      +  +     +P  P +R++ T  ++ S+A+IA+ V G GK + ++ AL  N  +++
Sbjct:   28 LAATLAHDVAERLRAAIAAKGQACVVLSGGRSPVPFLEKLASEP----LDWAKVTVSLADERWVPVEHADSNAGLLARHLLTGAAAKARFVGLYQQAENLDAAA--------------LKADQALTGLPPIDVLVLGMGDDGHTASLFPASPNLEAGLDLASTRRCLPLLAPSVPHQRLSMTRSLLASAAFIALSVQGPGKLATLRAALAGNDLTEM 226          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: G6PE_MOUSE (GDH/6PGL endoplasmic bifunctional protein OS=Mus musculus GN=H6pd PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 6.179e-17
Identity = 67/236 (28.39%), Postives = 111/236 (47.03%), Query Frame = 1
Query:  109 EDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSL-IDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQ-MALAEEEFTWFLDKXA 810
            E+L   LA      + +  +  G F + LSGGS  I   ++L    Y  S  WA  H++ VDER VP    DSN++      L  V +   N++ +   L     AE+ +    + ++ + L  +++     FDL+LLGMG DGH ASLFP  P   + ++ V  + +SP  P +R++ + P+IN +  +A++V G  K                 P+  +     +  W++D  A
Sbjct:  559 EELISKLASDIEAAAVQAVRHFGKFHLALSGGSSPIALFQQLATGHY--SFPWAHTHLWLVDERCVPLSDPDSNFQGLQAHLLQHVRVPYYNIHPMPVHLHQRLCAEEDQGAQTYASEISALVANSS-----FDLVLLGMGTDGHTASLFPQSPTGLDGDQLVV-LTESPFRPHQRMSLSLPLINRAKKVAVLVMGRTKREITTLVSRVGHEPKKWPISGVVPLSGQLVWYMDYEA 786          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: G6PE_HUMAN (GDH/6PGL endoplasmic bifunctional protein OS=Homo sapiens GN=H6PD PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 1.377e-16
Identity = 68/236 (28.81%), Postives = 108/236 (45.76%), Query Frame = 1
Query:  109 EDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSL-RKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEE-EFTWFLDKXA 810
            E+L   LA      + +  +  G F + LSGGS   +L ++L    Y     WA  H++ VDER VP    +SN++      L  V I   N++ +   L     AE+ +    +  + + L  +++     FDL+LLGMG DGH ASLFP  P   + E+ V  +  SP  P  R++ + P+IN +  +A++V G  K                 P+   L    +  W++D  A
Sbjct:  561 EELISKLANDIEATAVRAVRRFGQFHLALSGGSSPVALFQQLATAHY--GFPWAHTHLWLVDERCVPLSDPESNFQGLQAHLLQHVRIPYYNIHPMPVHLQQRLCAEEDQGAQIYAREISALVANSS-----FDLVLLGMGADGHTASLFPQSPTGLDGEQLVV-LTTSPSQPHRRMSLSLPLINRAKKVAVLVMGRMKREITTLVSRVGHEPKKWPISGVLPHSGQLVWYMDYDA 788          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_RHIME (6-phosphogluconolactonase OS=Rhizobium meliloti GN=pgl PE=3 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 2.870e-14
Identity = 65/233 (27.90%), Postives = 108/233 (46.35%), Query Frame = 1
Query:   85 NVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVT----FIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMAL 771
            N+ +F++   LA +LA       A     +G+ ++ +SGGS   +  + +    +D   W+K  V  VDER VP ++D SN++L  D  L         V     A +AE AA            +     +A+ G P  D+++LGMG DGH AS FPG   L+E     T       ++      R+TFTF  +  + Y+ + + G+GK   +  A  +   ++ +P++  L
Sbjct:    4 NMHIFENPSALAEALADDVGARLAAAIAARGTASLAVSGGSTPKAFFRSLSRRELD---WSKVTVTLVDERFVPPENDRSNHRLVADNLLKDGAAEARFVPLYQAAETAEAAA------------AIASGRTASLGAP-LDVVVLGMGTDGHTASFFPGGTRLEEALDPTTPRGVITMEAEGAGEPRLTFTFSSLQDAGYLVLHIEGSGKKEVLAQAEASGDEAE-MPIRAML 219          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_TREPA (6-phosphogluconolactonase OS=Treponema pallidum GN=pgl PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.860e-13
Identity = 49/172 (28.49%), Postives = 78/172 (45.35%), Query Frame = 1
Query:  187 VVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGK 702
            + LSGGS    + +     +   ++W +   FW DER VP     SN+ + +   L  + I    V+ +    + E A   Y   ++              G P FD++LLGMG DGH AS+FP H +   +      +   P    +R++FT  +IN++  I +VV G  K
Sbjct:   32 LALSGGSTPREIFRTWAHEFRHHLDWKRLRFFWSDERCVPPTDAQSNFNMTHSALLEPLEINPDAVFRVRGEDAPESACAAYSQEIE-------ARLPRQRGVPCFDIILLGMGADGHTASIFP-HEIELWDHSGCCVVATHPDTGQKRVSFTGHLINNAHEIYVVVTGREK 195          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_HAEIN (6-phosphogluconolactonase OS=Haemophilus influenzae GN=pgl PE=3 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 2.430e-13
Identity = 61/214 (28.50%), Postives = 92/214 (42.99%), Query Frame = 1
Query:  187 VVLSGGSLIDSLRK-LVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFT-WFLDKXATSKL 822
            + LSGGS    L K L + PY + I W   H +W D+R+VP    +SNY          + I   N++ I          + +E  L  +  + +           FD ++LGMG DGH ASLFP H    ++E  +  I   P+    RI+ T  +I  +  I  +V G  K+  ++        +   P     A+   T W+LDK A   L
Sbjct:   32 ISLSGGSTPKLLFKTLAKSPYAEQINWKNLHFWWGDDRMVPPSDPESNYGEVQKLLFDHIQIPAENIHRIRGENEPHFELKRFEEELSAVIPNGV-----------FDWIILGMGIDGHTASLFP-HQTNFDDEN-LAVIAKHPESGQIRISKTAKLIEQAKRITYLVTGESKADILKEIQTTPAENLPYPAAKIKAKNGVTEWYLDKAAVRLL 232          
The following BLAST results are available for this feature:
BLAST of DC900291 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 46
Match NameE-valueIdentityDescription
SOL2_YEAST1.983e-2334.516-phosphogluconolactonase-like protein 2 OS=Saccha... [more]
6PGL_CAEEL7.536e-2328.85Putative 6-phosphogluconolactonase OS=Caenorhabdit... [more]
6PGL_THEMA3.740e-2233.186-phosphogluconolactonase OS=Thermotoga maritima G... [more]
SOL4_YEAST8.332e-2232.326-phosphogluconolactonase 4 OS=Saccharomyces cerev... [more]
6PGL_PSEPU5.589e-1833.186-phosphogluconolactonase OS=Pseudomonas putida GN... [more]
G6PE_MOUSE6.179e-1728.39GDH/6PGL endoplasmic bifunctional protein OS=Mus m... [more]
G6PE_HUMAN1.377e-1628.81GDH/6PGL endoplasmic bifunctional protein OS=Homo ... [more]
6PGL_RHIME2.870e-1427.906-phosphogluconolactonase OS=Rhizobium meliloti GN... [more]
6PGL_TREPA1.860e-1328.496-phosphogluconolactonase OS=Treponema pallidum GN... [more]
6PGL_HAEIN2.430e-1328.506-phosphogluconolactonase OS=Haemophilus influenza... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900291 VSS Citrus sinensis cDNA clone VS28637 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900291 ID=DC900291|Name=DC900291|organism=Citrus sinensis|type=EST|length=991bp
GAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGACAAGGCATCATC
ATCAATGGCTGCCGAGAATAAGAACAAGAACAAGAACGTACAAGTTTTTG
ACTCAGAGGAAGATCTGGCTGTGTCTTTGGCCAAATACACCGCCGATCTA
TCTGCCAAGTTCGGTAAAGAGAAGGGCTCCTTCACTGTCGTCTTATCCGG
TGGTTCTCTCATCGACTCCCTCAGGAAATTAGTGGAACCCCCGTATGTAG
ATTCAATTGAATGGGCGAAATGGCATGTGTTTTGGGTTGATGAAAGAGTT
GTTCCCAAGGATCATGATGATAGCAATTATAAGCTTGCTTATGATGGTTT
CCTTTCTCAGGTACCAATTACCACTGGCAATGTCTATGCCATCAATGATG
CATTATCTGCTGAAGGTGCAGCTGAAGATTACGAGACTTGTCTCAAGCAT
TTGACAAAGAGCAATATATTAGCTACATCTGCTGCTACTGGTTTTCCAAA
GTTTGATCTCATGCTTCTGGGTATGGGTCCAGATGGACATATAGCTTCTC
TGTTTCCAGGGCATCCTCTTCTCAAGGAGAATGAGAAATGGGTTACTTTC
ATTAAAGACTCGCCAAAGCCACCTCCAGAGAGAATCACTTTCACCTTCCC
TGTAATCAACTCATCTGCATATATTGCAATGGTGGTGTGTGGTGCTGGAA
AATCAAGTGCAGTTCAAACTGCATTGGGTAATAATCAAAACTCTGATTTG
CTGCCAGTTCAAATGGCATTGGCTGAAGAAGAATTCACTTGGTTTCTTGA
CAAANACGCGACTTCAAAGCTGTAAGAGTCAGAACAATTTGCTGTATGCA
TGAATCCCTGTTATCTGCTATGATAATTGGTTTGATCTGTGTGGTTTGAC
TACTAGTACTGCTGGATTTTGTTAGTAATGAGAACAGAGTGAACTTGTTA
ATGCAAGTGAAAAAGATTTGAATAAATATAGTTTGATATTT
back to top