DC900291

Overview
NameDC900291
Unique NameDC900291
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length991
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900291_ssr1 microsatellite DC900291_ssr1:1..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig906 contig Csv1_Contig906:136..1126. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_AGGAC (6-phosphogluconolactonase OS=Aggregatibacter actinomycetemcomitans GN=pgl PE=3 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 2.430e-13
Identity = 59/214 (27.57%), Postives = 91/214 (42.52%), Query Frame = 1
Query:  187 VVLSGGSLIDSLRK-LVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFT-WFLDKXATSKL 822
            + LSGGS    L K L + PY + I W   H +W D+R+V     +SNY          + I   N++ I          + ++  L  +    +           FD ++LGMG DGH +SLFP H    ++E  +  I   P+    RI+ T  +I  +  I  +V G GK+  ++        +   P     A+   T W+LDK A   L
Sbjct:   32 ISLSGGSTPKLLFKTLAQSPYAEQINWRNLHFWWGDDRMVSPSDPESNYGEVQKLLFDHIQIPAENIHRIRGENEPHFELKRFQAELSAVISDGV-----------FDWIILGMGADGHTSSLFP-HQTNFDDEN-LAVIAKHPESGQIRISKTAKLIEQAKRITYLVTGEGKAEILKEIQSTPAENLPYPAAKIYAKNGVTEWYLDKDAAKLL 232          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_CHLMU (6-phosphogluconolactonase OS=Chlamydia muridarum GN=pgl PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 3.173e-13
Identity = 60/230 (26.09%), Postives = 101/230 (43.91%), Query Frame = 1
Query:   73 NKNKNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQ 762
            N    + + +S+ED            + K  +++G+F V LSGG     + + +        + +K  VFW DER        SNY  A D  L  + I    ++ + D  + +G  E YE  ++      I           FD+++LG+G DGH  SLFPG   L+E ++ V F  + P+    R+T TFP++  + ++   + G  K       L +    D  P++
Sbjct:    8 NDANRMLIAESQEDFLQIACYDWISTANKAIQKRGAFYVALSGGKTPLQIFQEIVKKRAAISDCSKIFVFWGDERASEDTEAGSNYLKAMD-ILKWLRIPDTQIFRM-DTANPKGD-EIYENLIREHVPDTI-----------FDMVMLGVGEDGHTLSLFPGTAALEEKDRLVVF-NEVPQLQTRRMTLTFPIVRQARHLVAYIQGTAKQDLCHKLL-HPLGRDTFPIE 221          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_BORBU (6-phosphogluconolactonase OS=Borrelia burgdorferi GN=pgl PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.687e-12
Identity = 54/205 (26.34%), Postives = 99/205 (48.29%), Query Frame = 1
Query:  166 KEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVP----ITTGNVYA-INDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQM 765
            K+K +   +  G S+++ L   ++     +  + + H F VDER VP + ++SNY L    F S++     I+    +A +   +    A  DY   ++  ++ NI           FD +++ +G DGHIASLFP   LL  + +   +  +SPK P +RI+ T   +  S  + ++  G  K  A++  L +N + +  P ++
Sbjct:   26 KDKYTSIGICGGRSIVNFLSVFLK----QNFSFRRSHFFLVDERCVPLNDENSNYNLLNKNFFSKMVDKNLISISKFHAFVYSEIDEATAIHDYN--IEFNSRFNI-----------FDFIIVSVGEDGHIASLFPSRKLLFSDVEGYQYEYNSPKFPSKRISLTPKSLFGSKAVVLLFMGVDKKCALENFLASNSSINECPARL 213          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_CHLTR (6-phosphogluconolactonase OS=Chlamydia trachomatis GN=pgl PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.021e-11
Identity = 58/210 (27.62%), Postives = 93/210 (44.29%), Query Frame = 1
Query:   73 NKNKNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGK 702
            N    + + DS+E+            + K   ++G+F V LSGG     + + +        + +K  VFW DER        SNY  A D  L  + I    ++ + D    +G  E YE  ++      I           FD+++LG+G DGH  SLFP    L+E E++V F  + P+    R+T TFP++  + ++   V G  K
Sbjct:    8 NDANRMLIADSQEEFLQIACYDWISTANKAIHKRGAFYVALSGGKTPLQIFQEIVKKRAAISDCSKIVVFWGDERANEDVEAGSNYLKAMD-ILKGLRIPEDQIFRM-DTADPKGD-EAYEALIQKYVPDAI-----------FDMVMLGVGEDGHTLSLFPETHALEEKERFVVF-NEVPQLHTRRMTLTFPIVRQARHLVAYVQGENK 202          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_CHLPN (6-phosphogluconolactonase OS=Chlamydia pneumoniae GN=pgl PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.333e-11
Identity = 56/200 (28.00%), Postives = 93/200 (46.50%), Query Frame = 1
Query:  166 KEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTA-LGNNQNSDLLPVQ 762
            K++G+F V LSGG     + K +       I+ +K  +FW DER+ P    +SNY  A    L  + I    ++ + +  + +GA +  E     L ++ I   S       FD+++LG+G DGH  SLF     L+E    V F    P    ER+T TFP ++   ++ + V G  K   +++      +   L P++
Sbjct:   39 KQRGAFYVALSGGKTPLEIYKDIVINKDKLIDPSKIFLFWGDERLAPITSSESNYGQAMS-ILRDLNIPDEQIFRM-ETENPDGAKKYQE-----LIENKIPDAS-------FDMIMLGLGEDGHTLSLFSNTSALEEENDLVVF-NSVPHLETERMTLTFPCVHKGKHVVVYVQGENKKPILKSVFFSEGREEKLYPIE 223          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_HELPY (6-phosphogluconolactonase OS=Helicobacter pylori GN=pgl PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.274e-11
Identity = 56/209 (26.79%), Postives = 92/209 (44.02%), Query Frame = 1
Query:  166 KEKGSFTVVLSGG-SLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFT 789
            K+    ++  SGG S I  L+KL     V +++W +  +  VDER++   HDDSN KL +D  L    +    +  + + +S++               +N L   A   F +  L +LGMG DGH ASLFP        EK    +      P ER++ +   + +   + + + G  K   ++ AL  N     LP+   L  ++ T
Sbjct:   31 KKHHQISIAFSGGRSPISLLQKLS----VLNLKWHECLISLVDERIIDTSHDDSNTKLLHDYLLQNNALKASFIPLLPEKISSD---------------TNALFNFANQHFKQPHLAILGMGTDGHTASLFPETSAFLNEEKENIVLTKPINAPYERLSMSVNALENCEKLFLSISGVEKRGVLEKALKENAPYS-LPIARILHSQKVT 219          
The following BLAST results are available for this feature:
BLAST of DC900291 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 46
Match NameE-valueIdentityDescription
6PGL_AGGAC2.430e-1327.576-phosphogluconolactonase OS=Aggregatibacter actin... [more]
6PGL_CHLMU3.173e-1326.096-phosphogluconolactonase OS=Chlamydia muridarum G... [more]
6PGL_BORBU2.687e-1226.346-phosphogluconolactonase OS=Borrelia burgdorferi ... [more]
6PGL_CHLTR1.021e-1127.626-phosphogluconolactonase OS=Chlamydia trachomatis... [more]
6PGL_CHLPN1.333e-1128.006-phosphogluconolactonase OS=Chlamydia pneumoniae ... [more]
6PGL_HELPY2.274e-1126.796-phosphogluconolactonase OS=Helicobacter pylori G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900291 VSS Citrus sinensis cDNA clone VS28637 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900291 ID=DC900291|Name=DC900291|organism=Citrus sinensis|type=EST|length=991bp
GAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGACAAGGCATCATC
ATCAATGGCTGCCGAGAATAAGAACAAGAACAAGAACGTACAAGTTTTTG
ACTCAGAGGAAGATCTGGCTGTGTCTTTGGCCAAATACACCGCCGATCTA
TCTGCCAAGTTCGGTAAAGAGAAGGGCTCCTTCACTGTCGTCTTATCCGG
TGGTTCTCTCATCGACTCCCTCAGGAAATTAGTGGAACCCCCGTATGTAG
ATTCAATTGAATGGGCGAAATGGCATGTGTTTTGGGTTGATGAAAGAGTT
GTTCCCAAGGATCATGATGATAGCAATTATAAGCTTGCTTATGATGGTTT
CCTTTCTCAGGTACCAATTACCACTGGCAATGTCTATGCCATCAATGATG
CATTATCTGCTGAAGGTGCAGCTGAAGATTACGAGACTTGTCTCAAGCAT
TTGACAAAGAGCAATATATTAGCTACATCTGCTGCTACTGGTTTTCCAAA
GTTTGATCTCATGCTTCTGGGTATGGGTCCAGATGGACATATAGCTTCTC
TGTTTCCAGGGCATCCTCTTCTCAAGGAGAATGAGAAATGGGTTACTTTC
ATTAAAGACTCGCCAAAGCCACCTCCAGAGAGAATCACTTTCACCTTCCC
TGTAATCAACTCATCTGCATATATTGCAATGGTGGTGTGTGGTGCTGGAA
AATCAAGTGCAGTTCAAACTGCATTGGGTAATAATCAAAACTCTGATTTG
CTGCCAGTTCAAATGGCATTGGCTGAAGAAGAATTCACTTGGTTTCTTGA
CAAANACGCGACTTCAAAGCTGTAAGAGTCAGAACAATTTGCTGTATGCA
TGAATCCCTGTTATCTGCTATGATAATTGGTTTGATCTGTGTGGTTTGAC
TACTAGTACTGCTGGATTTTGTTAGTAATGAGAACAGAGTGAACTTGTTA
ATGCAAGTGAAAAAGATTTGAATAAATATAGTTTGATATTT
back to top