DC900286

Overview
NameDC900286
Unique NameDC900286
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1248
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PAP1A_DICDI (Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.438e-24
Identity = 66/150 (44.00%), Postives = 97/150 (64.67%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGI-NKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHM-AGIEGSSANVIPSGYPSLYYT----TPPGIVSQVPPRP-GLMYQPLGLRTGWRAN 431
            N+Y+KNIDD + +++L+  FSQ GTITSA VM+D+K   +KGFGFVC+++P+EA++AV   +G M+  KPLYVA+AQRK+ R+A L++Q+ Q    GI         SG   +++T     P  +  Q+ PRP     QP+G+  G  AN
Sbjct:  285 NLYIKNIDDSIDNDKLREVFSQFGTITSAIVMKDDKATTSKGFGFVCYTAPDEATRAVTEMNGRMIGTKPLYVALAQRKDIRRAQLEMQHQQKFKTGIRQQMPPTYGSG--PVFFTPAPVNPQVVYQQMMPRPRNWNGQPVGVPQGQYAN 432          

HSP 2 Score: 78.1814 bits (191), Expect = 1.142e-13
Identity = 38/96 (39.58%), Postives = 56/96 (58.33%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGI 290
            NV+ KN+ +DV  ++LK    Q G IT+  +M D+KG +KGFGF  F S E A   V   +G + H KP+Y   AQ+K +R+A L+  +     G+
Sbjct:  189 NVFFKNLSEDVGPDQLKELLQQYGEITNITIMADDKGKSKGFGFANFESAEAAKNVVENENGKIFHGKPIYAGRAQKKIEREAELKHTFETKYQGV 284          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_SCHPO (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe GN=pab1 PE=1 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 1.438e-24
Identity = 71/163 (43.56%), Postives = 93/163 (57.06%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDR--------QAHLQLQYAQHMAGIEGSSANVIPSGYPSLY----YTTPPGI----VSQVPPRPGLMYQPLGLRTGWRANGFVP 443
            N+++KN+ D+V DE LKA FS  GTITSAK+M DE+G +KGFGFVC+++PEEA+KAV   +  ML  KPLYVA+AQRKE R        QA  Q +  Q +A   G  A    +  P +Y    Y  P  +    +  VP   G M    G+ T + A G  P
Sbjct:  365 NLFIKNLQDEVDDERLKAEFSAFGTITSAKIMTDEQGKSKGFGFVCYTTPEEANKAVTEMNQRMLAGKPLYVALAQRKEVRRSQLEAQIQARNQFRLQQQVAAAAGIPAVQYGATGPLIYGPGGYPIPAAVNGRGMPMVPGHNGPMPMYPGMPTQFPAGGPAP 527          

HSP 2 Score: 73.559 bits (179), Expect = 2.812e-12
Identity = 36/91 (39.56%), Postives = 57/91 (62.64%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVY+KN+D ++T++E    F Q G ITS  +++D+    +GFGFV +++ E A KAV+  +      K LYV  AQ+K +R+  L+ +Y Q
Sbjct:  262 NVYIKNLDTEITEQEFSDLFGQFGEITSLSLVKDQNDKPRGFGFVNYANHECAQKAVDELNDKEYKGKKLYVGRAQKKHEREEELRKRYEQ 352          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: EPAB_XENTR (Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.438e-24
Identity = 61/116 (52.59%), Postives = 78/116 (67.24%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVIPSGYPSLYYTTP 350
            N+YVKN+DD + D+ L+  FS  GTITSAKVM  E G +KGFGFVCFSSPEEA+KAV   +G ++  KPLYVA+AQRKE+R+A L  QY Q +A +      ++ S      Y  P
Sbjct:  295 NLYVKNLDDGIDDDRLRKEFSPYGTITSAKVMT-EGGHSKGFGFVCFSSPEEATKAVTEMNGRIVSTKPLYVALAQRKEERKAILTNQYMQRLATMRAMPGPLLGSFQQPANYFLP 409          

HSP 2 Score: 77.0258 bits (188), Expect = 2.544e-13
Identity = 37/91 (40.66%), Postives = 59/91 (64.84%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVY+KN  +D+ D+ L+  FS  G   S KVM D+ G ++GFGFV + + EEA KAV+  +G  ++ + +YV  AQ++ +RQ  L+ ++ Q
Sbjct:  192 NVYIKNFGEDMDDKRLREIFSAFGNTLSVKVMMDDTGRSRGFGFVNYGNHEEAQKAVSEMNGKEVNGRMIYVGRAQKRIERQGELKRKFEQ 282          

HSP 3 Score: 71.633 bits (174), Expect = 1.072e-11
Identity = 37/77 (48.05%), Postives = 51/77 (66.23%), Query Frame = 1
Query:  739 LAAASPEQQKQILGERLYPLVEKHKPDLVAKITGMLLQMDNXXXXXXXXXXXXXAVKVEEAVQVLKLSEAKVSTQEA 969
            LA+A P++QKQ+LGERLYPL+ +  P L  KITGMLL++DN               KVEEAV VL+  +AK ++Q++
Sbjct:  547 LASAPPQEQKQMLGERLYPLIHEMHPTLAGKITGMLLEIDNSELLHMLESPESLHSKVEEAVAVLQAHQAKENSQKS 623          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: EPABA_XENLA (Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-A PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 2.452e-24
Identity = 72/155 (46.45%), Postives = 94/155 (60.65%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVIPS-GYPSLYYTTPPGIVSQVPPRPGLMYQPLGLRTGWRANGFVPPTRPAFQ 464
            N+YVKN+DD + D+ L+  F   GTITSAKVM  E G +KGFGFVCFSSPEEA+KAV   +G ++  KPLYVA+AQRKE+R+A L  QY Q +A +      ++ S   P+ Y+      +S +P  P         RT +  N  V P RPA Q
Sbjct:  295 NLYVKNLDDGIDDDRLRKEFLPYGTITSAKVMT-EGGHSKGFGFVCFSSPEEATKAVTEMNGRIVSTKPLYVALAQRKEERKAILTNQYMQRLATMRAMPGPLLGSFQQPANYF------LSAMPQPPN--------RTFYSPNP-VAPVRPAPQ 433          

HSP 2 Score: 77.7962 bits (190), Expect = 1.491e-13
Identity = 37/91 (40.66%), Postives = 60/91 (65.93%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVY+KN  +D+ D+ L+  FS  G   S KVM D+ G ++GFGFV + + EEA KAV+  +G  ++ + +YV  AQ++ +RQ+ L+ ++ Q
Sbjct:  192 NVYIKNFGEDMDDKRLREIFSAFGNTLSVKVMMDDSGRSRGFGFVNYGNHEEAQKAVSEMNGKEVNGRMIYVGRAQKRIERQSELKRKFEQ 282          

HSP 3 Score: 73.1738 bits (178), Expect = 3.686e-12
Identity = 37/95 (38.95%), Postives = 57/95 (60.00%), Query Frame = 1
Query:  703 VMARKPDMLNGMLAAASPEQQKQILGERLYPLVEKHKPDLVAKITGMLLQMDNXXXXXXXXXXXXXAVKVEEAVQVLKLSEAKVSTQEAIHPNYL 987
            +M  +  +   +LA A P++QKQ+LGER+YP++ +  P L  KITGMLL++DN               KVEEAV VL+  +AK + Q++  P+ +
Sbjct:  535 LMQGQEPLTASLLAGAPPQEQKQMLGERIYPVIHEMHPTLAGKITGMLLEIDNSELLHMLESPESLHSKVEEAVAVLQAHQAKENAQKSAQPSLI 629          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: EPABB_XENLA (Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-B PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 4.183e-24
Identity = 60/116 (51.72%), Postives = 77/116 (66.38%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVIPSGYPSLYYTTP 350
            N+YVKN+DD + D+ L+  FS  GTITS KVM  E G +KGFGFVCFSSPEEA+KAV   +G ++  KPLYVA+AQRKE+R+A L  QY Q +A +      ++ S      Y  P
Sbjct:  295 NLYVKNLDDGIDDDRLRKEFSPYGTITSTKVMT-EGGHSKGFGFVCFSSPEEATKAVTEMNGRIVSTKPLYVALAQRKEERKAILTNQYMQRLATMRAMPGPLLGSFQQPANYFLP 409          

HSP 2 Score: 77.0258 bits (188), Expect = 2.544e-13
Identity = 38/91 (41.76%), Postives = 57/91 (62.64%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVY+KN  +D+ D+ LK  FS  G   S KVM D  G ++GFGFV + + EEA KAV   +G  ++ + +YV  AQ++ +RQ  L+ ++ Q
Sbjct:  192 NVYIKNFGEDMDDKRLKEIFSAFGNTLSVKVMMDNSGRSRGFGFVNYGNHEEAQKAVTEMNGKEVNGRMVYVGRAQKRIERQGELKRKFEQ 282          

HSP 3 Score: 69.3218 bits (168), Expect = 5.322e-11
Identity = 39/95 (41.05%), Postives = 55/95 (57.89%), Query Frame = 1
Query:  685 LLNSGGVMARKPDMLNGMLAAASPEQQKQILGERLYPLVEKHKPDLVAKITGMLLQMDNXXXXXXXXXXXXXAVKVEEAVQVLKLSEAKVSTQEA 969
            +L    +M  +  +   +LAAA  ++QKQILGER+YPL+ +  P L  KITGMLL++DN               KVEEAV VL+  +AK S  ++
Sbjct:  529 VLEPAVLMQGQEPLTASLLAAAPLQEQKQILGERIYPLIHEMHPTLAGKITGMLLEIDNSELLHMLESPESLHSKVEEAVAVLQAHQAKESAPKS 623          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_USTMA (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis GN=PAB1 PE=3 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 7.136e-24
Identity = 62/141 (43.97%), Postives = 84/141 (59.57%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVIPSGY--PSLYYTTP---PGIVSQVPPRPGLMYQPLGL 410
            N+Y+KNI +   DE L+  F+  G ITS K+MR   G+++GFGFVC+S+PEEA+KAV+  +G ML  +PLYVA+AQRK+ R+  L+ Q  Q         A     GY  P +YY  P   PG    + PRP   Y P G+
Sbjct:  331 NLYLKNIPESYDDERLREEFAPFGAITSCKIMRAPSGVSRGFGFVCYSAPEEANKAVSEMNGKMLDNRPLYVALAQRKDVRRQQLEAQIMQRNQLRLQQQAAAQGMGYPGPGMYYPQPGAFPGQPGGMVPRP--RYAPAGM 469          

HSP 2 Score: 81.6481 bits (200), Expect = 1.033e-14
Identity = 41/89 (46.07%), Postives = 56/89 (62.92%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NVY KN+D +VTD+E +  F++ G ITS  + RDE G +KGFGFV F    EA KAV+  H      + L+VA AQ+K +R+  L+  Y
Sbjct:  228 NVYAKNVDPEVTDDEFEKLFTKFGKITSCVLQRDEDGKSKGFGFVNFEDHNEAQKAVDELHDSDFKGQKLFVARAQKKSEREEELRRSY 316          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_CANAL (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans GN=PAB1 PE=3 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 2.712e-23
Identity = 61/144 (42.36%), Postives = 92/144 (63.89%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQ-YAQHMAGIEGSSANVIPSGY-PSLYYTT----PPGIVSQVP---PRPGLMYQPLG 407
            N++VKN+DD +  E+L+  F   GTITSAKVM DE G +KGFGFVCF++PEEA+KA+   +  M++ KPLYVA+AQRK+ R++ L+ Q  A++   ++ ++A  +P  + P ++Y      PP      P   P P +M +  G
Sbjct:  337 NLFVKNLDDTIDSEKLEEEFKPFGTITSAKVMVDEAGKSKGFGFVCFTTPEEATKAITEMNTRMINGKPLYVALAQRKDVRRSQLEQQIQARNQMRMQNAAAGGLPGQFIPPMFYGQQGFFPPNGRGNAPYPGPNPQMMMRGRG 480          

HSP 2 Score: 70.4774 bits (171), Expect = 2.381e-11
Identity = 37/89 (41.57%), Postives = 54/89 (60.67%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            N+YVKNID + ++E  +  FS  G ITS  + +D+ G +KGFGFV F   E A KAV   +   ++ + +YV  AQ+K +R   L+ QY
Sbjct:  234 NIYVKNIDLNYSEESFEKLFSPFGKITSIYLEKDQDGKSKGFGFVNFEDHESAVKAVEELNDKEINGQKIYVGRAQKKRERLEELKKQY 322          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_DEBHA (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii GN=PAB1 PE=3 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 3.541e-23
Identity = 56/121 (46.28%), Postives = 81/121 (66.94%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHL--QLQYAQHMAGIEGSSANVIPSGY-PSLYYTTPPG 356
            N+++KN+DD +  E+L+  F   G+ITSA+VM DE G +KGFGFVCFSSPEEA+KA+   +  M++ KPLYVA+AQRK+ R++ L  Q+Q    M     ++   IP  + P ++Y   PG
Sbjct:  336 NLFIKNLDDTIDSEKLEEEFKPFGSITSARVMVDETGKSKGFGFVCFSSPEEATKAITEMNQRMIYGKPLYVALAQRKDVRRSQLEQQIQARNQMRMQNAAATGGIPGQFIPPMFYGQQPG 456          

HSP 2 Score: 73.9442 bits (180), Expect = 2.153e-12
Identity = 39/89 (43.82%), Postives = 55/89 (61.80%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NVY KNID D ++EE K  F   G ITS  + +D +G +KGFGFV F + E A KAV+  +   ++ + +YV  AQ+K +R   L+ QY
Sbjct:  233 NVYAKNIDLDFSEEEFKKLFEAYGKITSIYLEKDHEGKSKGFGFVNFENHESAVKAVDELNDKEINGQKIYVGRAQKKRERLEELKKQY 321          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_PICGU (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Pichia guilliermondii GN=PAB1 PE=3 SV=2)

HSP 1 Score: 109.383 bits (272), Expect = 4.625e-23
Identity = 61/142 (42.96%), Postives = 86/142 (60.56%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHL--QLQYAQHMAGIEGSSANVIPSGYPS-LYYTTPPGIV---------SQVPPRPGLM 392
            N++VKN+DD +  E+L+  F   GTITSA+VM D+ G +KGFGFVCFSSPEEA+KA+   +  M+  KPLYVA+AQRK+ R++ L  Q+Q    M     ++A  +P  + S ++Y   PG              PP P +M
Sbjct:  343 NLFVKNLDDSIDSEKLEEEFKPFGTITSARVMVDDAGKSKGFGFVCFSSPEEATKAITEMNQRMIQGKPLYVALAQRKDVRRSQLEQQIQARNQMRMQNAAAAAGMPGQFMSPMFYGQQPGFFPPNGRGGAQGPFPPNPQMM 484          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_PICST (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Pichia stipitis GN=PAB1 PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 1.030e-22
Identity = 67/170 (39.41%), Postives = 93/170 (54.71%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHL--QLQYAQHMAGIEGSSANVIPSGY-PSLYYTT----PPGIVSQVP---PRPGLMY---QPLGLRTGWRANGFVPPTRPAFQVSP 473
            N+++KN+DD +  E+L+  F   GTITSA+VM DE G +KGFGFVCFSSPEEA+KA+   +  M   KPLYVA+AQRK+ R++ L  Q+Q    M     ++   IP  + P ++Y      PP      P   P P ++    QP G    W   G      P + + P
Sbjct:  337 NLFIKNLDDTIDSEKLEEEFKPFGTITSARVMVDETGKSKGFGFVCFSSPEEATKAITEMNQRMFFGKPLYVALAQRKDVRRSQLEQQIQARNQMRMQNAAATGGIPGQFIPPMFYGQQGFFPPNGRGNAPFPGPNPQMIMRRGQPFGGPEQWPRPGPNGQPVPVYGIPP 506          

HSP 2 Score: 72.7886 bits (177), Expect = 4.797e-12
Identity = 37/89 (41.57%), Postives = 56/89 (62.92%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            N+YVKNID + ++E+LK  F+  G ITS  + +D +G +KGFGFV +   E A KAV   +   ++ + +YV  AQ+K +R   L+ QY
Sbjct:  234 NIYVKNIDLEYSEEDLKKLFTPYGAITSIYLEKDAEGKSKGFGFVNYEGHEAAVKAVEELNDKEINGQKIYVGRAQKKRERMEELKKQY 322          
The following BLAST results are available for this feature:
BLAST of DC900286 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
PAP1A_DICDI1.438e-2444.00Polyadenylate-binding protein 1-A OS=Dictyostelium... [more]
PABP_SCHPO1.438e-2443.56Polyadenylate-binding protein, cytoplasmic and nuc... [more]
EPAB_XENTR1.438e-2452.59Embryonic polyadenylate-binding protein OS=Xenopus... [more]
EPABA_XENLA2.452e-2446.45Embryonic polyadenylate-binding protein A OS=Xenop... [more]
EPABB_XENLA4.183e-2451.72Embryonic polyadenylate-binding protein B OS=Xenop... [more]
PABP_USTMA7.136e-2443.97Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_CANAL2.712e-2342.36Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_DEBHA3.541e-2346.28Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_PICGU4.625e-2342.96Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_PICST1.030e-2239.41Polyadenylate-binding protein, cytoplasmic and nuc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900286 VSS Citrus sinensis cDNA clone VS28632 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900286 ID=DC900286|Name=DC900286|organism=Citrus sinensis|type=EST|length=1248bp
CAAATGTTTATGTGAAGAACATTGATGATGATGTTACCGATGAAGAGCTA
AAAGCGCACTTCAGTCAGTGTGGCACAATTACTTCAGCAAAAGTGATGCG
AGATGAGAAAGGAATAAATAAGGGCTTTGGATTTGTGTGCTTCTCAAGCC
CAGAGGAGGCCAGTAAAGCTGTGAACACTTTCCATGGTTACATGTTACAC
CGCAAGCCATTGTACGTGGCTATTGCTCAAAGGAAGGAGGACAGACAAGC
ACATCTGCAACTTCAGTATGCACAGCATATGGCTGGAATAGAAGGAAGTT
CAGCTAATGTTATTCCCAGTGGATATCCTTCTCTTTACTACACAACTCCT
CCAGGTATTGTTTCACAAGTACCACCACGTCCTGGGCTGATGTACCAACC
TTTGGGTTTGAGGACGGGTTGGAGGGCCAATGGCTTTGTGCCACCAACCA
GACCAGCATTTCAAGTATCACCACTGCCAGTTAACCCAAAACACAATAGG
CAAAACAGAGGTAGGATGAATGGGAATATGCTTCCACAAGTAGGTGCTCA
CTATATGCAACAGTCCTCTCAATCTGCAGCTTCTTCAAAAGATTCAAGCA
ATCAACAGAAGGGTGGGCAAAGCAAGTATGTACCAAATGGTCGTACACGT
GAGTTAAACAAAGGATCTGGAGTCTCATTAGGTACTTTTAAATTCTGGTG
GAGTAATGGCGCGGAAACCAGATATGCTCAATGGTATGCTTGCCGCAGCT
TCCCCTGAGCAACAAAAACAGATACTTGGAGAGCGTCTGTACCCTCTTGT
CGAGAAACACAAGCCTGATCTTGTTGCCAAAATTACGGGAATGCTACTAC
AGATGGACAACTCGGAACTGCTGCTGTTATTGGAATCACCAGAGTCATTG
GCTGTAAAAGTGGAGGAAGCTGTGCAAGTGCTAAAGCTCTCAGAAGCCAA
AGTTTCAACTCAGGAAGCCATTCATCCCAATTACCTATCTGCTGAGGTTG
CAGTCAATTGAGAAGGCAAGCCCAAATTGTGCTGAAAAATATAGAGGTGC
TCACCAAATCGAAGAGGCCAAACTTGTTTTTGATACCATTAGCGAACATT
CATTTAGTTCATTTGTTTCTTTTTTTTTGTTTTTTTTTAACTGTTATTAG
AATCATTTTCTTTTTGGGTATAGGACATTGTTTCGTGTCTTTATTGAAGA
AGAAAGATTGATACTGTTGATCCTATGTTTATTTAACTGACAACTATT
back to top