DC900286

Overview
NameDC900286
Unique NameDC900286
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1248
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_ASPOR (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae GN=pab1 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 9.341e-16
Identity = 42/89 (47.19%), Postives = 60/89 (67.42%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NVY+KNID DVT+EE +  F + G ITSA + RD++G ++GFGFV FS+ E A  AV+  +   +  + LYV  AQ+K +R+  L+ QY
Sbjct:  231 NVYIKNIDQDVTEEEFRELFEKFGEITSATLSRDQEGKSRGFGFVNFSTHESAQAAVDEMNEKEIRTQKLYVGRAQKKHEREEELRKQY 319          

HSP 2 Score: 74.3294 bits (181), Expect = 1.649e-12
Identity = 52/133 (39.10%), Postives = 78/133 (58.65%), Query Frame = 3
Query:  102 DEKGI--NKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQ--LQYAQHMAGIEGSSANVIPSGY--PSLYYTTPPGIVSQVP-PRPGLMYQPLGLRTGWRANGFVPPTRPAFQVSPLP 479
            D+KG+  +KGFGFVCFSSP+EASKAV   +  M++ KPLYVA+AQRK+ R++ L+  +Q    +   + ++A  +P  Y  P+++Y   PG    +P  R G+ + P   + G    G +P  RP     P P
Sbjct:  425 DKKGLGKSKGFGFVCFSSPDEASKAVTEMNQRMVNGKPLYVALAQRKDVRRSQLEASIQARNTIRQQQAAAAAGMPQPYMQPAVFY--GPGQQGFIPGQRGGIAFPP---QPGMVMAG-IPGGRPGQYPGPFP 551          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PAB4L_HUMAN (Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.593e-15
Identity = 39/76 (51.32%), Postives = 58/76 (76.32%), Query Frame = 3
Query:    6 VYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQR 233
            +Y+KN+DD + DE+L+  FS  G+I+  KVM++E G +KGFG +CFSSPE+A+KA+   +G +L  KPL +A+AQR
Sbjct:  295 LYIKNLDDTIDDEKLRNEFSSFGSISRVKVMQEE-GQSKGFGLICFSSPEDATKAMTEMNGRILGSKPLSIALAQR 369          

HSP 2 Score: 80.1073 bits (196), Expect = 3.005e-14
Identity = 42/91 (46.15%), Postives = 56/91 (61.54%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVY+KN   D+ DE LK  FS+ G   S KVM D  G +KGFGFV F S E A KAV   +G  ++ + ++V  AQ+K +RQA L+  + Q
Sbjct:  191 NVYIKNFGGDMDDERLKDVFSKYGKTLSVKVMTDSSGKSKGFGFVSFDSHEAAKKAVEEMNGRDINGQLIFVGRAQKKVERQAELKQMFEQ 281          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_ASPNC (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 2.718e-15
Identity = 70/223 (31.39%), Postives = 92/223 (41.26%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAK------VMRDEK---------------------------------------------------GINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQL----------QYAQHMAGIE-----------GSSANVIPSGYPSLYYTTPPGIVSQVP-PRPGLMYQPLGLRTGWRANG 434
            N+YVKN+ DD+ DE+L+  F   GTITSAK      V RD+                                                    G +KGFGFVCFSSP+EASKAV   +  M++ KPLYVA+AQRK+ R++ L+           Q A   AG+                  IP G   + +   PG+V  +P  RPG    P   + G R  G
Sbjct:  339 NLYVKNLTDDIDDEKLRELFGPYGTITSAKVMRDTNVERDQSPDSAGKEKEADKENDKEATPEAEKAEKAEEKPSESSEEKDKEAKKSDKKPFGKSKGFGFVCFSSPDEASKAVTEMNQRMVNGKPLYVALAQRKDVRRSQLEASIQARNTIRQQQAAAAAGMPQPYMQPAVFYGPGQQGFIPGGQRGMAFPPQPGMVMGIPGGRPGQYPGPFPGQQGGRGMG 561          

HSP 2 Score: 80.8777 bits (198), Expect = 1.762e-14
Identity = 38/89 (42.70%), Postives = 58/89 (65.17%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NVY+KN+D ++ D+E +  F + G ITSA + RD++G ++GFGFV FS+ E A  AV   +   +  + LYV  AQ+K +R+  L+ QY
Sbjct:  236 NVYIKNLDSEIDDDEFRKMFEKFGEITSATLSRDQEGKSRGFGFVNFSTHESAQAAVEEMNDKEIRSQKLYVGRAQKKHEREEELRKQY 324          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP5_PONPY (Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 7.908e-15
Identity = 43/89 (48.31%), Postives = 57/89 (64.04%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NV+VKNI DD+ DE+LK  F + G   S KV+RD  G +KGFGFV + + E A KAV   HG  +  K LYV  AQ+K +R A L+ ++
Sbjct:  200 NVFVKNIGDDIDDEKLKELFCEYGPTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRF 288          

HSP 2 Score: 78.9518 bits (193), Expect = 6.694e-14
Identity = 39/77 (50.65%), Postives = 55/77 (71.43%), Query Frame = 3
Query:    6 VYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRK 236
            +Y+KN+D+ + DE+LK  FS  G+I+ AKVM  E G  KGFG VCFSS EEA+KAV+  +G ++  KPL+V + Q +
Sbjct:  304 IYIKNLDETINDEKLKEEFSSFGSISRAKVMM-EVGQGKGFGVVCFSSFEEATKAVDEMNGRIVGSKPLHVTLGQAR 379          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP5_PANTR (Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 7.908e-15
Identity = 43/89 (48.31%), Postives = 57/89 (64.04%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NV+VKNI DD+ DE+LK  F + G   S KV+RD  G +KGFGFV + + E A KAV   HG  +  K LYV  AQ+K +R A L+ ++
Sbjct:  200 NVFVKNIGDDIDDEKLKELFCEYGPTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRF 288          

HSP 2 Score: 78.9518 bits (193), Expect = 6.694e-14
Identity = 39/77 (50.65%), Postives = 55/77 (71.43%), Query Frame = 3
Query:    6 VYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRK 236
            +Y+KN+D+ + DE+LK  FS  G+I+ AKVM  E G  KGFG VCFSS EEA+KAV+  +G ++  KPL+V + Q +
Sbjct:  304 IYIKNLDETINDEKLKEEFSSFGSISRAKVMM-EVGQGKGFGVVCFSSFEEATKAVDEMNGRIVGSKPLHVTLGQAR 379          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP5_MACMU (Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 7.908e-15
Identity = 43/89 (48.31%), Postives = 57/89 (64.04%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NV+VKNI DD+ DE+LK  F + G   S KV+RD  G +KGFGFV + + E A KAV   HG  +  K LYV  AQ+K +R A L+ ++
Sbjct:  200 NVFVKNIGDDIDDEKLKELFCEYGPTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRF 288          

HSP 2 Score: 78.9518 bits (193), Expect = 6.694e-14
Identity = 39/77 (50.65%), Postives = 55/77 (71.43%), Query Frame = 3
Query:    6 VYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRK 236
            +Y+KN+D+ + DE+LK  FS  G+I+ AKVM  E G  KGFG VCFSS EEA+KAV+  +G ++  KPL+V + Q +
Sbjct:  304 IYIKNLDETINDEKLKEEFSSFGSISRAKVMM-EVGQGKGFGVVCFSSFEEATKAVDEMNGRVVGSKPLHVTLGQAR 379          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP5_HYLLA (Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 7.908e-15
Identity = 43/89 (48.31%), Postives = 57/89 (64.04%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NV+VKNI DD+ DE+LK  F + G   S KV+RD  G +KGFGFV + + E A KAV   HG  +  K LYV  AQ+K +R A L+ ++
Sbjct:  200 NVFVKNIGDDIDDEKLKELFCEYGPTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRF 288          

HSP 2 Score: 78.9518 bits (193), Expect = 6.694e-14
Identity = 39/77 (50.65%), Postives = 55/77 (71.43%), Query Frame = 3
Query:    6 VYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRK 236
            +Y+KN+D+ + DE+LK  FS  G+I+ AKVM  E G  KGFG VCFSS EEA+KAV+  +G ++  KPL+V + Q +
Sbjct:  304 IYIKNLDETINDEKLKEEFSSFGSISRAKVMM-EVGQGKGFGVVCFSSFEEATKAVDEMNGRIVGSKPLHVTLGQAR 379          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP5_HUMAN (Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 7.908e-15
Identity = 43/89 (48.31%), Postives = 57/89 (64.04%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NV+VKNI DD+ DE+LK  F + G   S KV+RD  G +KGFGFV + + E A KAV   HG  +  K LYV  AQ+K +R A L+ ++
Sbjct:  200 NVFVKNIGDDIDDEKLKELFCEYGPTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRF 288          

HSP 2 Score: 78.9518 bits (193), Expect = 6.694e-14
Identity = 39/77 (50.65%), Postives = 55/77 (71.43%), Query Frame = 3
Query:    6 VYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRK 236
            +Y+KN+D+ + DE+LK  FS  G+I+ AKVM  E G  KGFG VCFSS EEA+KAV+  +G ++  KPL+V + Q +
Sbjct:  304 IYIKNLDETINDEKLKEEFSSFGSISRAKVMM-EVGQGKGFGVVCFSSFEEATKAVDEMNGRIVGSKPLHVTLGQAR 379          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP5_GORGO (Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 7.908e-15
Identity = 43/89 (48.31%), Postives = 57/89 (64.04%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NV+VKNI DD+ DE+LK  F + G   S KV+RD  G +KGFGFV + + E A KAV   HG  +  K LYV  AQ+K +R A L+ ++
Sbjct:  200 NVFVKNIGDDIDDEKLKELFCEYGPTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRF 288          

HSP 2 Score: 78.9518 bits (193), Expect = 6.694e-14
Identity = 39/77 (50.65%), Postives = 55/77 (71.43%), Query Frame = 3
Query:    6 VYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRK 236
            +Y+KN+D+ + DE+LK  FS  G+I+ AKVM  E G  KGFG VCFSS EEA+KAV+  +G ++  KPL+V + Q +
Sbjct:  304 IYIKNLDETINDEKLKEEFSSFGSISRAKVMM-EVGQGKGFGVVCFSSFEEATKAVDEMNGRIVGSKPLHVTLGQAR 379          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_MAGGR (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe grisea GN=PAB1 PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.301e-14
Identity = 41/90 (45.56%), Postives = 60/90 (66.67%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRD-EKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            N+YVKNI+ +VTD+E +  F + G +TS+ + RD E G ++GFGFV F+S E+ASKAV   +    H + LYV  AQ+K +R+  L+  Y
Sbjct:  243 NIYVKNINPEVTDDEFRTLFEKYGDVTSSSLARDQETGKSRGFGFVNFTSHEDASKAVQELNEKEFHGQNLYVGRAQKKHEREEELRKSY 332          
The following BLAST results are available for this feature:
BLAST of DC900286 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
PABP_ASPOR9.341e-1647.19Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PAB4L_HUMAN1.593e-1551.32Polyadenylate-binding protein 4-like OS=Homo sapie... [more]
PABP_ASPNC2.718e-1531.39Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP5_PONPY7.908e-1548.31Polyadenylate-binding protein 5 OS=Pongo pygmaeus ... [more]
PABP5_PANTR7.908e-1548.31Polyadenylate-binding protein 5 OS=Pan troglodytes... [more]
PABP5_MACMU7.908e-1548.31Polyadenylate-binding protein 5 OS=Macaca mulatta ... [more]
PABP5_HYLLA7.908e-1548.31Polyadenylate-binding protein 5 OS=Hylobates lar G... [more]
PABP5_HUMAN7.908e-1548.31Polyadenylate-binding protein 5 OS=Homo sapiens GN... [more]
PABP5_GORGO7.908e-1548.31Polyadenylate-binding protein 5 OS=Gorilla gorilla... [more]
PABP_MAGGR2.301e-1445.56Polyadenylate-binding protein, cytoplasmic and nuc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900286 VSS Citrus sinensis cDNA clone VS28632 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900286 ID=DC900286|Name=DC900286|organism=Citrus sinensis|type=EST|length=1248bp
CAAATGTTTATGTGAAGAACATTGATGATGATGTTACCGATGAAGAGCTA
AAAGCGCACTTCAGTCAGTGTGGCACAATTACTTCAGCAAAAGTGATGCG
AGATGAGAAAGGAATAAATAAGGGCTTTGGATTTGTGTGCTTCTCAAGCC
CAGAGGAGGCCAGTAAAGCTGTGAACACTTTCCATGGTTACATGTTACAC
CGCAAGCCATTGTACGTGGCTATTGCTCAAAGGAAGGAGGACAGACAAGC
ACATCTGCAACTTCAGTATGCACAGCATATGGCTGGAATAGAAGGAAGTT
CAGCTAATGTTATTCCCAGTGGATATCCTTCTCTTTACTACACAACTCCT
CCAGGTATTGTTTCACAAGTACCACCACGTCCTGGGCTGATGTACCAACC
TTTGGGTTTGAGGACGGGTTGGAGGGCCAATGGCTTTGTGCCACCAACCA
GACCAGCATTTCAAGTATCACCACTGCCAGTTAACCCAAAACACAATAGG
CAAAACAGAGGTAGGATGAATGGGAATATGCTTCCACAAGTAGGTGCTCA
CTATATGCAACAGTCCTCTCAATCTGCAGCTTCTTCAAAAGATTCAAGCA
ATCAACAGAAGGGTGGGCAAAGCAAGTATGTACCAAATGGTCGTACACGT
GAGTTAAACAAAGGATCTGGAGTCTCATTAGGTACTTTTAAATTCTGGTG
GAGTAATGGCGCGGAAACCAGATATGCTCAATGGTATGCTTGCCGCAGCT
TCCCCTGAGCAACAAAAACAGATACTTGGAGAGCGTCTGTACCCTCTTGT
CGAGAAACACAAGCCTGATCTTGTTGCCAAAATTACGGGAATGCTACTAC
AGATGGACAACTCGGAACTGCTGCTGTTATTGGAATCACCAGAGTCATTG
GCTGTAAAAGTGGAGGAAGCTGTGCAAGTGCTAAAGCTCTCAGAAGCCAA
AGTTTCAACTCAGGAAGCCATTCATCCCAATTACCTATCTGCTGAGGTTG
CAGTCAATTGAGAAGGCAAGCCCAAATTGTGCTGAAAAATATAGAGGTGC
TCACCAAATCGAAGAGGCCAAACTTGTTTTTGATACCATTAGCGAACATT
CATTTAGTTCATTTGTTTCTTTTTTTTTGTTTTTTTTTAACTGTTATTAG
AATCATTTTCTTTTTGGGTATAGGACATTGTTTCGTGTCTTTATTGAAGA
AGAAAGATTGATACTGTTGATCCTATGTTTATTTAACTGACAACTATT
back to top