DC900286

Overview
NameDC900286
Unique NameDC900286
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1248
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_CHAGB (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum GN=PAB1 PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.948e-13
Identity = 38/89 (42.70%), Postives = 58/89 (65.17%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            N+YVKNI  + TDEE +  F++ G +TS+ + RD +G ++GFGFV F++ E A+KAV   +G     + LYV  AQ+K +R+  L+  Y
Sbjct:  247 NIYVKNISLEATDEEFRDLFAKYGDVTSSSLARDSEGKSRGFGFVNFTTHECAAKAVEELNGKEFRGQDLYVGRAQKKHEREEELRKSY 335          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: MUG28_SCHPO (Meiotically up-regulated gene 28 protein OS=Schizosaccharomyces pombe GN=mug28 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 3.110e-11
Identity = 39/108 (36.11%), Postives = 65/108 (60.19%), Query Frame = 3
Query:    3 NVYVKNIDDDVTD--EELKAHFSQCGTITSAKVMR-DEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVIP 317
            N++VKN+DD++    ++L+  FS+ G I S  +       I+KG+GFV FS P EA +A+NT +G +  +K L+V  A+++EDR+  L   ++Q    +  S +  IP
Sbjct:  420 NLFVKNLDDNIVGNTQQLEELFSKFGRIKSCTLASYPSTEISKGYGFVSFSHPFEAVQAINTLNGVLFGKKRLFVNYAEKREDRKKRLSAIFSQSYPPVVPSPSLTIP 527          
The following BLAST results are available for this feature:
BLAST of DC900286 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
PABP_CHAGB1.948e-1342.70Polyadenylate-binding protein, cytoplasmic and nuc... [more]
MUG28_SCHPO3.110e-1136.11Meiotically up-regulated gene 28 protein OS=Schizo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900286 VSS Citrus sinensis cDNA clone VS28632 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900286 ID=DC900286|Name=DC900286|organism=Citrus sinensis|type=EST|length=1248bp
CAAATGTTTATGTGAAGAACATTGATGATGATGTTACCGATGAAGAGCTA
AAAGCGCACTTCAGTCAGTGTGGCACAATTACTTCAGCAAAAGTGATGCG
AGATGAGAAAGGAATAAATAAGGGCTTTGGATTTGTGTGCTTCTCAAGCC
CAGAGGAGGCCAGTAAAGCTGTGAACACTTTCCATGGTTACATGTTACAC
CGCAAGCCATTGTACGTGGCTATTGCTCAAAGGAAGGAGGACAGACAAGC
ACATCTGCAACTTCAGTATGCACAGCATATGGCTGGAATAGAAGGAAGTT
CAGCTAATGTTATTCCCAGTGGATATCCTTCTCTTTACTACACAACTCCT
CCAGGTATTGTTTCACAAGTACCACCACGTCCTGGGCTGATGTACCAACC
TTTGGGTTTGAGGACGGGTTGGAGGGCCAATGGCTTTGTGCCACCAACCA
GACCAGCATTTCAAGTATCACCACTGCCAGTTAACCCAAAACACAATAGG
CAAAACAGAGGTAGGATGAATGGGAATATGCTTCCACAAGTAGGTGCTCA
CTATATGCAACAGTCCTCTCAATCTGCAGCTTCTTCAAAAGATTCAAGCA
ATCAACAGAAGGGTGGGCAAAGCAAGTATGTACCAAATGGTCGTACACGT
GAGTTAAACAAAGGATCTGGAGTCTCATTAGGTACTTTTAAATTCTGGTG
GAGTAATGGCGCGGAAACCAGATATGCTCAATGGTATGCTTGCCGCAGCT
TCCCCTGAGCAACAAAAACAGATACTTGGAGAGCGTCTGTACCCTCTTGT
CGAGAAACACAAGCCTGATCTTGTTGCCAAAATTACGGGAATGCTACTAC
AGATGGACAACTCGGAACTGCTGCTGTTATTGGAATCACCAGAGTCATTG
GCTGTAAAAGTGGAGGAAGCTGTGCAAGTGCTAAAGCTCTCAGAAGCCAA
AGTTTCAACTCAGGAAGCCATTCATCCCAATTACCTATCTGCTGAGGTTG
CAGTCAATTGAGAAGGCAAGCCCAAATTGTGCTGAAAAATATAGAGGTGC
TCACCAAATCGAAGAGGCCAAACTTGTTTTTGATACCATTAGCGAACATT
CATTTAGTTCATTTGTTTCTTTTTTTTTGTTTTTTTTTAACTGTTATTAG
AATCATTTTCTTTTTGGGTATAGGACATTGTTTCGTGTCTTTATTGAAGA
AGAAAGATTGATACTGTTGATCCTATGTTTATTTAACTGACAACTATT
back to top