DC900278

Overview
NameDC900278
Unique NameDC900278
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1108
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5649 contig Csv1_Contig5649:1..1108. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA4_RAT (Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 2.243e-34
Identity = 102/313 (32.59%), Postives = 158/313 (50.48%), Query Frame = 1
Query:    7 FYQTTNPDVAKIFHLDSEVNRPALVMVKKEAEKISY--------FDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLI--------FVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGE-LTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNE--HHRAKSDGFPTILFFPAGNKSFDPINVD-VDRTVVALYKFLKKNAS 885
            F+ T + ++AK      +V+   LV+++ E  +  Y          G  + S I D+V  + LPLV      N    +    K  L++   S D       +  A + ++ K++        + +   D ED    V +  G++     V A   ++  KK  ++ E    D ++ F   F  GK+KP  KS P+P+ N G V++VVG  FD IV+D  KDVL+E YAPWCGHC+  EP Y  L K  +G   +VIAKMD T N+  + R K +GFPTI F P+G+K  +PI  +  +R +  L KF+ ++A+
Sbjct:  334 FHHTFSTEIAKFL----KVSLGKLVLMQPEKFQSKYEPRMHVMDVQGSTEASAIKDYVVKHALPLVGHRKTSNDAKRYS---KRPLVVVYYSVDFSF---DYRTATQFWRNKVLEVAKDFPEYTFAIADEEDYATEVKD-LGLSESGEDVNAAILDESGKKFAMEPEEFDSDALQEFVMAFKKGKLKPVIKSQPVPKNNKGPVRVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPVYTSLGKKYKGQKDLVIAKMDATANDITNDRYKVEGFPTIYFAPSGDKK-NPIKFEGGNRDLEHLSKFIDEHAT 634          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA3_BOVIN (Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 3.827e-34
Identity = 85/189 (44.97%), Postives = 114/189 (60.32%), Query Frame = 1
Query:  388 TGEAPKVLAYTGNDDAKKHILDGELTLD--KIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNE-HHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASE 945
            TGE P V   T   +  K ++  E + D   ++ F ED+  G +K + KS+PIPE+NDG VK+VV  NFDEIV +E+KDVL+E YAPWCGHC+  EP Y +L + LR   +IVIAKMD T N+     +  GFPTI F PA NK  +P   +  R +     +LK+ A+ P  IQ+    PK +K A E
Sbjct:  320 TGEIPVVAVRTAKGE--KFVMQEEFSRDGKALERFLEDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLRKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPA-NKKQNPKKYEGGRELSDFISYLKREATNPPVIQE--EKPKKKKKAQE 503          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA2_PONAB (Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 3.827e-34
Identity = 95/292 (32.53%), Postives = 147/292 (50.34%), Query Frame = 1
Query:  130 DKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDS--EKLLPVFEEAAKSFKGKLIFVYVQM--DNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKH--ILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIP-ETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAESSDIKGSHE 984
            D   ++ F+ ++ + LVT F  + +  +F + I N LLLF     +   +LL  F EAA  F+G+++FV V +  DNE V     +YFG+  EA   L     +  KK+  +  G +T   I  F    L G+VKP+  S  +P + +   VK +VG NF+++  DE+K+V ++ YAPWC HC+   P +  LA+  +  + ++IA++D T NE       GFPT+ +FPAG      I     R +    KFL     +      PT  P  E  A  P+  ++   GS E
Sbjct:  243 DLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLVGFGEAAPHFRGQVLFVVVDVAADNEHV----LQYFGLKAEAAPTLRLVNLETTKKYAPVDGGPVTTASITAFCHAVLNGQVKPYLLSQEVPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDVIIAELDATANELDAFAVHGFPTLKYFPAG-PGRKVIEYKSTRDLGTFSKFLDNGGVL------PTEEPLEEPAAPFPEPPANSTMGSKE 523          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI1_ARATH (Probable protein disulfide-isomerase 1 OS=Arabidopsis thaliana GN=At1g21750 PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 1.454e-33
Identity = 106/307 (34.53%), Postives = 160/307 (52.12%), Query Frame = 1
Query:   52 DSEVNRPALVMVKKEAEKISYFDGK-FDKSTIADFVFSNKLPLVTIFTRE--NAPSV---FESP-IKNQLLLFAVSNDSEKLLPVFEEAAKSFKGK-LIFVYVQMDNEDVGKPVSEYFGIT-GEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSD--GFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASI---PFKIQKPTSAPKTE 930
            +S V  P + + K   E+  + D K FD   +  FV  + +PL+T+F ++  N P V   FES   K  L +      +E L   + E A S KG+ L F+    +N    +   +YFG+   + P ++  T +D   K  L   + +D+I+++ +DF  GK+ P  KS PIP  N+  VK+VV ++ D+IVL+  K+VLLE YAPWCGHCQ   P  +++A   +   S+VIAK+D T N+  +   D  GFPTI F  A   S + +  + DRT      F+ KN      P K ++ T   K E
Sbjct:  205 ESSVTGPVVRLFKPFDEQ--FVDSKDFDGEALEKFVKESSIPLITVFDKDPNNHPYVIKFFESTNTKAMLFINFTGEGAESLKSKYREVATSNKGQGLSFLLGDAENS---QGAFQYFGLEESQVPLIIIQTADD---KKYLKTNVEVDQIESWVKDFKDGKIAPHKKSQPIPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSA---SGNVVVYEGDRTKEDFISFVDKNKDTVGEPKKEEETTEEVKDE 500          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI_ASPNG (Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 2.480e-33
Identity = 94/282 (33.33%), Postives = 145/282 (51.42%), Query Frame = 1
Query:   61 VNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFG-ITGEAPKVLAYTGNDDAK--KHILDG--ELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKL----AKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKN 879
            V +P++V+ K   EK + +DG+ ++  I  +V S   PLV     E       + +    +      + EK    F+  A+  KG +    +        K    + G +  ++ K  A+   D AK  K+  D   EL  D+++ F +D L GKV+P  KS+P+PE+ +G V +VV +++ ++V+D  KDVLLE YAPWCGHC+A  P Y++L    A H      + IAK+D T N+     + GFPT+  +PAG K   PI     RTV  L  F+K+N
Sbjct:  195 VEQPSIVLYKDFDEKKAVYDGEIEQEAIHSWVKSASTPLVGEIGPETYSGYIGAGVPLAYIFAETKEEREKYTEDFKPIAQKHKGAINIATID------AKMFGAHAGNLNLDSQKFPAFAIQDPAKNAKYPYDQAKELNADEVEKFIQDVLDGKVEPSIKSEPVPESQEGPVTVVVAHSYKDLVIDNDKDVLLEFYAPWCGHCKALAPKYDELAALYADHPDLAAKVTIAKIDATANDVPDPIT-GFPTLRLYPAGAKD-SPIEYSGSRTVEDLANFVKEN 468          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA4_BOVIN (Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 7.217e-33
Identity = 96/308 (31.17%), Postives = 151/308 (49.03%), Query Frame = 1
Query:    7 FYQTTNPDVAKIFHLDSEVNRPALVMVKKEAEKISYFDGKF--------DKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEKLLPVFE----EAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILD-GELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNE--HHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNAS 885
            F+ T + ++AK      +V+   LV+++ E  +  Y    +        + + I + V  + LPLV      +A      P+         S D       +     E AK F     + +   D ED    + +  G++    +V A   ++  ++  ++  +   D ++ F   F  GK+KP  KS P+P+ N G VK+VVG  FD IV+D  KDVL+E YAPWCGHC+  EP Y  L K  +G  ++VIAKMD T N+    R K +GFPTI F P+G+K       D +R +  L KF++++A+
Sbjct:  335 FHHTFSTEIAKFL----KVSLGKLVVMQPEKFQSKYEPKSYVMDIKDSTEAAAITEHVVKHTLPLVGHRKAADAKRYTRRPLVVVYYSVDFSFDYRAATQFWRNKVLEVAKDFPE---YTFAVADEEDFATELKD-LGLSESGEEVNAAILDEGGRRFAMEPDDFDADALRDFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYTSLGKKYKGHKNLVIAKMDATANDVTSDRYKVEGFPTIYFAPSGDKKKPIKFEDGNRDLEHLSKFIEEHAT 634          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA3_PONAB (Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 2.100e-32
Identity = 105/308 (34.09%), Postives = 154/308 (50.00%), Query Frame = 1
Query:   67 RPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSN-DSEKLLP--------VFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGI---TGEAPKVLAYTGNDDAKKHILDGELTLD--KIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNE-HHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASE 945
            RP+ +  K E + ++Y + K     I  F+  N   +    T +N     +  I+ + LL A  + D EK           V   A K         +     +     +S+ FG+    GE P V   T   +  K ++  E + D   ++ F +D+  G +K + KS+PIPE+NDG VK+VV  NFDEIV +E+KDVL+E YAPWCGHC+  EP Y +L + L    +IVIAKMD T N+     +  GFPTI F PA NK  +P   +  R +     +L++ A+ P  IQ+    PK +K A E
Sbjct:  207 RPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDN-----KDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSD-FGLESTAGEIPVVAIRTAKGE--KFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPA-NKKLNPKKYEGGRELSDFISYLQREATNPPVIQE--EKPKKKKKAQE 503          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA3_HUMAN (Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4)

HSP 1 Score: 140.198 bits (352), Expect = 2.100e-32
Identity = 105/308 (34.09%), Postives = 154/308 (50.00%), Query Frame = 1
Query:   67 RPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSN-DSEKLLP--------VFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGI---TGEAPKVLAYTGNDDAKKHILDGELTLD--KIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNE-HHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASE 945
            RP+ +  K E + ++Y + K     I  F+  N   +    T +N     +  I+ + LL A  + D EK           V   A K         +     +     +S+ FG+    GE P V   T   +  K ++  E + D   ++ F +D+  G +K + KS+PIPE+NDG VK+VV  NFDEIV +E+KDVL+E YAPWCGHC+  EP Y +L + L    +IVIAKMD T N+     +  GFPTI F PA NK  +P   +  R +     +L++ A+ P  IQ+    PK +K A E
Sbjct:  207 RPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDN-----KDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSD-FGLESTAGEIPVVAIRTAKGE--KFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPA-NKKLNPKKYEGGRELSDFISYLQREATNPPVIQE--EKPKKKKKAQE 503          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA3_CERAE (Protein disulfide-isomerase A3 OS=Cercopithecus aethiops GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 2.100e-32
Identity = 105/308 (34.09%), Postives = 154/308 (50.00%), Query Frame = 1
Query:   67 RPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSN-DSEKLLP--------VFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGI---TGEAPKVLAYTGNDDAKKHILDGELTLD--KIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNE-HHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASE 945
            RP+ +  K E + ++Y + K     I  F+  N   +    T +N     +  I+ + LL A  + D EK           V   A K         +     +     +S+ FG+    GE P V   T   +  K ++  E + D   ++ F +D+  G +K + KS+PIPE+NDG VK+VV  NFDEIV +E+KDVL+E YAPWCGHC+  EP Y +L + L    +IVIAKMD T N+     +  GFPTI F PA NK  +P   +  R +     +L++ A+ P  IQ+    PK +K A E
Sbjct:  207 RPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDN-----KDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSD-FGLESTAGEIPVVAIRTAKGE--KFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPA-NKKLNPKKYEGGRELSDFISYLQREATNPPVIQE--EKPKKKKKAQE 503          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI_MEDSA (Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 3.582e-32
Identity = 98/311 (31.51%), Postives = 155/311 (49.84%), Query Frame = 1
Query:   52 DSEVNRPALVMVKKEAEKISYFDGK-FDKSTIADFVFSNKLPLVTIFTRE--NAPSV---FESP-IKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSD--GFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAE 957
            DS V+ P + + K   E   + D K F+   +  F+  +  P+VT+F  E  N P V   F SP  K  L +   +  +E     + E A+ +K + +   V   + +  +   +YFG+  E   ++    ND  K       L LD++ T+ + +  GKV+PF KS+PIPETN+  VK+VVG   +++V    K+VL+E YAPWCGHC+   P  +++A   +    +VIAK+D T N+      D  G+PT+ F  A  K       D  RT   + +F++KN        +    PK    A++P+AE
Sbjct:  208 DSSVSGPVVRLFKPFDEL--FVDSKDFNVEALEKFIEESSTPIVTVFNNEPSNHPFVVKFFNSPNAKAMLFINFTTEGAESFKTKYHEVAEQYKQQGVSFLV--GDVESSQGAFQYFGLKEEQVPLIIIQHNDGKK--FFKPNLELDQLPTWLKAYKDGKVEPFVKSEPIPETNNEPVKVVVGQTLEDVVFKSGKNVLIEFYAPWCGHCKQLAPILDEVAVSFQSDADVVIAKLDATANDIPTDTFDVQGYPTLYFRSASGKL---SQYDGGRTKEDIIEFIEKNKDKTGAAHQEVEQPKA---AAQPEAE 506          
The following BLAST results are available for this feature:
BLAST of DC900278 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
PDIA4_RAT2.243e-3432.59Protein disulfide-isomerase A4 OS=Rattus norvegicu... [more]
PDIA3_BOVIN3.827e-3444.97Protein disulfide-isomerase A3 OS=Bos taurus GN=PD... [more]
PDIA2_PONAB3.827e-3432.53Protein disulfide-isomerase A2 OS=Pongo abelii GN=... [more]
PDI1_ARATH1.454e-3334.53Probable protein disulfide-isomerase 1 OS=Arabidop... [more]
PDI_ASPNG2.480e-3333.33Protein disulfide-isomerase OS=Aspergillus niger G... [more]
PDIA4_BOVIN7.217e-3331.17Protein disulfide-isomerase A4 OS=Bos taurus GN=PD... [more]
PDIA3_PONAB2.100e-3234.09Protein disulfide-isomerase A3 OS=Pongo abelii GN=... [more]
PDIA3_HUMAN2.100e-3234.09Protein disulfide-isomerase A3 OS=Homo sapiens GN=... [more]
PDIA3_CERAE2.100e-3234.09Protein disulfide-isomerase A3 OS=Cercopithecus ae... [more]
PDI_MEDSA3.582e-3231.51Protein disulfide-isomerase OS=Medicago sativa GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900278 VSS Citrus sinensis cDNA clone VS28624 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900278 ID=DC900278|Name=DC900278|organism=Citrus sinensis|type=EST|length=1108bp
GTCAACTTCTATCAAACTACAAATCCTGATGTGGCAAAGATTTTCCACCT
TGATTCTGAAGTCAATCGCCCGGCTCTGGTCATGGTTAAGAAGGAGGCTG
AGAAAATAAGCTATTTTGATGGGAAATTTGATAAGTCTACTATTGCTGAT
TTTGTATTTTCAAACAAGCTTCCTTTAGTCACCATTTTTACAAGGGAAAA
TGCCCCTTCAGTTTTTGAAAGTCCAATTAAGAATCAGCTGCTATTGTTTG
CTGTTTCAAATGACTCAGAAAAGCTTTTACCAGTATTCGAAGAAGCCGCA
AAATCTTTCAAGGGAAAGCTTATTTTTGTGTATGTCCAAATGGACAATGA
AGATGTCGGAAAGCCTGTTTCAGAGTATTTTGGCATCACTGGGGAAGCTC
CCAAAGTTCTTGCATACACGGGGAATGATGACGCTAAAAAACATATCCTG
GATGGAGAGTTGACCTTGGATAAAATTAAGACTTTTGGAGAGGATTTCCT
CGCAGGCAAGGTTAAGCCTTTCTTTAAGTCTGATCCAATTCCAGAAACTA
ATGATGGAGATGTGAAAATAGTGGTTGGAAATAACTTTGATGAAATTGTC
TTGGATGAGTCAAAGGATGTTCTTCTGGAGATCTATGCCCCTTGGTGTGG
GCATTGCCAAGCCTTCGAGCCAACCTACAACAAACTGGCCAAACATCTAC
GTGGCGTTGATTCTATTGTTATCGCTAAGATGGATGGCACGACAAATGAA
CATCACAGGGCAAAGTCTGATGGATTCCCAACAATTCTTTTCTTCCCAGC
TGGAAACAAGAGTTTTGATCCTATCAATGTAGATGTTGACCGTACTGTGG
TGGCATTGTACAAGTTTCTTAAGAAAAATGCTTCAATCCCCTTTAAAATC
CAGAAGCCAACATCAGCACCCAAGACAGAGAAACCAGCTTCGGAACCAAA
AGCTGAGTCCTCGGATATCAAAGGGAGCCACGAGAGCAGTAGCGANAAAG
ATGTGAAGGACGAATTGTAACTTGCCTAAAACAAGGAAGATGATATACAA
CGGGTGTAATGCTAAANTTANTGTACACCTTTTATCAGTCATCAGGTACT
AGAAAGAA
back to top