DC900278

Overview
NameDC900278
Unique NameDC900278
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1108
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5649 contig Csv1_Contig5649:1..1108. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA3_MOUSE (Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2)

HSP 1 Score: 136.732 bits (343), Expect = 2.322e-31
Identity = 79/189 (41.80%), Postives = 111/189 (58.73%), Query Frame = 1
Query:  388 TGEAPKVLAYTGNDDAKKHILDGELTLD--KIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNE-HHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASE 945
            TGE P V   T   +  K ++  E + D   ++ F +++  G +K + KS+PIPE+N+G VK+VV  NFD+IV +E KDVL+E YAPWCGHC+  EP Y +L + L    +IVIAKMD T N+     +  GFPTI F PA NK   P   +  R +     +L++ A+ P  IQ+    PK +K A E
Sbjct:  320 TGEVPVVAIRTAKGE--KFVMQEEFSRDGKALEQFLQEYFDGNLKRYLKSEPIPESNEGPVKVVVAENFDDIVNEEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPA-NKKLTPKKYEGGRELNDFISYLQREATNPPIIQE--EKPKKKKKAQE 503          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA4_CAEEL (Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=2 SV=2)

HSP 1 Score: 135.576 bits (340), Expect = 5.172e-31
Identity = 98/294 (33.33%), Postives = 153/294 (52.04%), Query Frame = 1
Query:   70 PALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLI----------FVYVQMDNEDVGKPVSEY-FGITGEAPKVLAYTGNDDAKKHIL-----DGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVD-SIVIAKMDGTTNE-HHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFK 897
            P+L   K E +  +Y         +  F   +  PLV   T++NA + +    K  L++   + D       + E ++ ++ K++          + +   D E+  K + E   G +G    V+ +    D KK+ +     DGEL  + ++ F +   +GK K   KS P P+ + G VK VVG+NFD+IV DESKDVL+E YAPWCGHC++FE  Y +LA+ L+    ++V+AKMD T N+   +   +GFPTI F PAG KS +PI    +R +  L KF+ K+    F+
Sbjct:  330 PSLFHSKFEPKSRTYNKAAATSEDLLAFFREHSAPLVGKMTKKNAATRYT---KKPLVVVYYNADFSVQ---YREGSEYWRSKVLNIAQKYQKDKYKFAVADEEEFAKELEELGLGDSGLEHNVVVF--GYDGKKYPMNPDEFDGELD-ENLEAFMKQISSGKAKAHVKSAPAPKDDKGPVKTVVGSNFDKIVNDESKDVLIEFYAPWCGHCKSFESKYVELAQALKKTQPNVVLAKMDATINDAPSQFAVEGFPTIYFAPAGKKS-EPIKYSGNRDLEDLKKFMTKHGVKSFQ 613          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA3_RAT (Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 1.152e-30
Identity = 79/189 (41.80%), Postives = 110/189 (58.20%), Query Frame = 1
Query:  388 TGEAPKVLAYTGNDDAKKHILDGELTLD--KIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNE-HHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASE 945
            TGE P V   T   +  K ++  E + D   ++ F +++  G +K + KS+PIPETN+G VK+VV  +FD+IV  E KDVL+E YAPWCGHC+  EP Y +L + L    +IVIAKMD T N+     +  GFPTI F PA NK   P   +  R +     +L++ A+ P  IQ+    PK +K A E
Sbjct:  320 TGEIPVVAIRTAKGE--KFVMQEEFSRDGKALERFLQEYFDGNLKRYLKSEPIPETNEGPVKVVVAESFDDIVNAEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPA-NKKLTPKKYEGGRELNDFISYLQREATNPPIIQE--EKPKKKKKAQE 503          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI2_ARATH (Protein disulfide-isomerase 2 OS=Arabidopsis thaliana GN=At1g77510 PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.152e-30
Identity = 104/316 (32.91%), Postives = 159/316 (50.32%), Query Frame = 1
Query:   34 AKIFHLDSEVNRPALVMVKKEAEKISYFDGK-FDKSTIADFVFSNKLPLVTIFTRE--NAPSV---FESPIKNQLLLFAVSN-DSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGIT-GEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSD--GFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPK 951
            AK       V  PA+ + K   E   + D K F+   +  FV  + +PLVT+F  +  N P V   FESP    ++    +   +E L   + E A S K + +   V   + +  +   +YFG+   + P ++  T   D KK+ L   + +D+I+++ +DF  GKV    KS PIP  N+  VK+VV  + D+IV    K+VL+E YAPWCGHCQ   P  +++A   +   S++IAK+D T N+      D  GFPTI F  A   S + +  + DRT      F++KN+      +KPTS  +    + EPK
Sbjct:  197 AKFLPRGESVEGPAVRLFKPFDEL--FVDSKDFNGEALEKFVKESSIPLVTVFDSDPNNHPYVAKFFESPATKAMMFVNFTGATAEALKSKYREVATSNKDQSLAFLV--GDAESSQGAFQYFGLEESQVPLIIIQT--PDNKKY-LKVNVEVDQIESWFKDFQDGKVAVHKKSQPIPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVALSFQNDPSVIIAKLDATANDIPSDTFDVKGFPTIYFRSA---SGNVVVYEGDRTKEDFINFVEKNSE-----KKPTSHGEESTKSEEPK 497          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI_DATGL (Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 2.567e-30
Identity = 98/310 (31.61%), Postives = 151/310 (48.71%), Query Frame = 1
Query:   52 DSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRE--NAPSVFE----SPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSD--GFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAE 957
            +S V+ P + + K   E    F   FD + +   V  + +P VTIF ++  N P V +    +  K  L L   S   E    ++ E A+  KG+ I   +       G    +YFG+  +   ++    ND  K   L   L  D I ++ +++   K+ P+ KS+PIPE N+  VK+VV ++ DEIV    K+VLLE YAPWCGHC+   P  +++A        ++IAK+D T N++     D  G+PT+ F  A   S + +  D  RT     +F++KN     K  K  S  K ++  SE KAE
Sbjct:  208 ESSVSGPVVRLFKPFDELFVDFQD-FDVNALEKLVEESSVPTVTIFDKDPSNHPFVVKFFNNANAKAMLFLNFTSEVVESFRSIYREVAEKNKGEGISFLIGDTESSQG--AFQYFGLRDDQVPLIVIQNNDGTK--YLKPNLEPDHIASWVKEYKDCKLSPYRKSEPIPEHNNEPVKVVVADSLDEIVFKSGKNVLLEFYAPWCGHCKQLAPILDEVAVSFENDPDVLIAKLDATANDYPTNTFDVKGYPTLYFKSA---SGELLQYDGGRTKEDFIEFIEKNRE---KSSKKESIVKDDQTDSETKAE 506          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI1_CAEEL (Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 7.468e-30
Identity = 81/253 (32.02%), Postives = 138/253 (54.55%), Query Frame = 1
Query:  142 IADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDS--EKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGE---APKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPET-NDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNA 882
            +  ++ + KL  VT FT E+A  +    +K    L    +DS  ++ +  F E AK F+ K++FV + +D E+  + + E+ G+  +   A ++++     +  K   +GE      + F   +L GK     K+  +PE  N   VK++V +NF+EI LDE+K V ++ YAPWCGHC+   P +++LA+      ++VIAK+D T NE    K + FPT+  +PAG+ +  P++ D DR +    +F+ K A
Sbjct:  225 LKQWLHAYKLSAVTEFTHESAQEIVGGDLKKFHFLIIRKSDSSFDETIAKFTEVAKKFRAKIVFVLLDVDVEENAR-ILEFLGVDAKNTPANRIVSLADQVEKFKP-QEGE----DFEAFTNSYLEGKSAQDLKAQDLPEDWNALPVKVLVASNFNEIALDETKTVFVKFYAPWCGHCKQLVPVWDELAEKYESNPNVVIAKLDATLNELADVKVNSFPTLKLWPAGSST--PVDYDGDRNLEKFEEFVNKYA 469          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI_HORVU (Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2)

HSP 1 Score: 130.183 bits (326), Expect = 2.173e-29
Identity = 100/311 (32.15%), Postives = 157/311 (50.48%), Query Frame = 1
Query:   52 DSEVNRPALVMVKKEAEKISYFDGK-FDKSTIADFVFSNKLPLVTIFTR--ENAPSV---FESPIKNQLLLFAVSNDS-EKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGI-TGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNE-HHRAKSDGFPTILFF-PAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKA 954
            D+ V RP + + K   E +   D K FD S +  F+ ++  P V IF +  +N P +   F+S     +L    S    E     +  A + F GK +   +       G    +YFG+   +AP +L   G  D+KK + +  +   +I  + +D+  GK+ PF KS+PIPE N+  VK+VV +N  ++V    K+VL+E YAPWCGHC+   P  ++ A  L+  + +VIAKMD T N+        G+PT+ F  P+G K    ++ +  RT   +  +++KN     K     +A  TEK A+EP A
Sbjct:  212 DAAVERPVVRLFKPFDELV--VDSKDFDVSALEKFIDASSTPKVVIFDKNPDNHPYLLKFFQSNAPKAMLFLNFSTGPFESFKSAYYGAVEEFSGKDVKFLIGDIESSQG--AFQYFGLKVDQAPLILIQDG--DSKKFLKE-HVEAGQIVAWLKDYFDGKLTPFRKSEPIPEANNEPVKVVVADNVHDVVFKSGKNVLIEFYAPWCGHCKKLAPILDEAAATLQSEEDVVIAKMDATENDVPGEFDVQGYPTLYFVTPSGKK----VSYEGGRTADEIVDYIRKN-----KETAGQAAAATEK-AAEPAA 505          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI_RICCO (Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 6.322e-29
Identity = 89/284 (31.34%), Postives = 142/284 (50.00%), Query Frame = 1
Query:   52 DSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRE--NAPSV---FESPIKNQLLLFAVSNDS-EKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSD--GFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKN 879
            +S V  P + + K   E    F   F+   +  FV  + +P+VT+F  +  N P V   F SP    +L    + ++ + +   ++E A  FKG+ I +   + + +  +   +YFG+  +   ++    ND  K   L   L  D I  + + +  GKV+ + KS+PIPE N+  VK+VV +   +IV +  K+VLLE YAPWCGHC+   P  +++A   +    IVIAK+D T N+      D  G+PT+ F  A  K       D DRT   +  F++KN
Sbjct:  207 ESSVTGPVVRLFKPFDELFVDFKD-FNVDALEKFVEESSMPVVTVFNSDPSNHPFVIKFFNSPDAKAMLFMNFNGEAADSIKSKYQEVAHQFKGEGIILL--LGDVEASQGAFQYFGLKEDQVPLIIIQTNDGQK--YLKANLEPDHIAPWVKAYKEGKVQAYRKSEPIPEVNNEPVKVVVADTLQDIVFNSGKNVLLEFYAPWCGHCKQLAPILDEVAVSYKSDADIVIAKLDATANDIPSDTFDVRGYPTVYFRSASGK---VEQYDGDRTKDDIISFIEKN 482          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI_MAIZE (Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 8.257e-29
Identity = 101/330 (30.61%), Postives = 158/330 (47.88%), Query Frame = 1
Query:   52 DSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTR--ENAPSVFE----SPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGIT-GEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNE-HHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAESSDIKGSHESSSXKDVKDEL 1017
            D+ V RP LV + K  +++      FD + +  F+ ++ +P V  F +  +N P + +    S  K  L L   +   +     +  AA+ FK K I   +   + +  +   +YFG+   + P +L   G  D+KK  L   +  D+I  + +++  GK+ PF  S+PIPE N+  VK+VV +N  + V    K+VL+E YAPWCGHC+   P  ++ A  L+  + +VIAKMD T N+        G+PT+ F     K     + D  RT   +  F+KK+        K T+AP        P A      G  E S  + VKDEL
Sbjct:  209 DAAVERP-LVRLLKPFDELVVDSKDFDVAALMKFIDASTIPRVVTFDKNPDNHPYLMKFFQSSAPKAMLFLNFSTGPFDSFKSAYSAAAEEFKDKEIKFLI--GDIEASQGAFQYFGLKEDQTPLILIQDG--DSKK-FLKVHVEADQIVAWLKEYFDGKLTPFRNSEPIPEVNNEPVKVVVADNVHDFVFKSGKNVLIEFYAPWCGHCKKLAPILDEAATTLQSDEEVVIAKMDATANDVPSEFDVQGYPTLYFVTPSGK---VTSYDSGRTADDIVDFIKKS--------KETAAPHHH---HHPGA-----TGIREGSRAEPVKDEL 513          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI_WHEAT (Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 1.408e-28
Identity = 90/308 (29.22%), Postives = 151/308 (49.03%), Query Frame = 1
Query:   52 DSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTR--ENAPSV---FESPIKNQLLLFAVSNDS-EKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGIT-GEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNE-HHRAKSDGFPTILFF-PAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEP 948
            D+ V RP LV + K  +++      FD S +  F+ ++  P V  F +  +N P +   F+S     +L    S    E     +  A + F GK +   +   + +  +   +Y G+   +AP +L     D   K  L  ++   +I  + +D+  GK+ PF KS+PIPE N+  VK+VV +N  ++V   +K+VL+E YAPWCGHC+   P  ++ A  L+  + +VIAK+D T N+        G+PT+ F  P+G K    ++ +  RT   +  ++KKN     +     +    E  A+EP
Sbjct:  213 DAAVERP-LVRLFKPFDELVVDSKDFDVSALEKFIDASSTPKVVTFDKNPDNHPYLLKYFQSNAPKAMLFLNFSTGPFESFKSAYYGAVEEFSGKDVKFLI--GDIEASQGAFQYNGLKEDQAPLILI---QDSDSKKFLKEQVEAGQIVAWLKDYFDGKLTPFRKSEPIPEANNEPVKVVVADNIHDVVFKSAKNVLIEFYAPWCGHCKKLAPILDEAAATLQSEEDVVIAKIDATANDVPGEFDVQGYPTLYFVTPSGKK----VSYEGGRTADEIVDYIKKNKETAGQAAAAATEKAAEPAATEP 510          
The following BLAST results are available for this feature:
BLAST of DC900278 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
PDIA3_MOUSE2.322e-3141.80Protein disulfide-isomerase A3 OS=Mus musculus GN=... [more]
PDIA4_CAEEL5.172e-3133.33Probable protein disulfide-isomerase A4 OS=Caenorh... [more]
PDIA3_RAT1.152e-3041.80Protein disulfide-isomerase A3 OS=Rattus norvegicu... [more]
PDI2_ARATH1.152e-3032.91Protein disulfide-isomerase 2 OS=Arabidopsis thali... [more]
PDI_DATGL2.567e-3031.61Protein disulfide-isomerase OS=Datisca glomerata G... [more]
PDI1_CAEEL7.468e-3032.02Protein disulfide-isomerase 1 OS=Caenorhabditis el... [more]
PDI_HORVU2.173e-2932.15Protein disulfide-isomerase OS=Hordeum vulgare GN=... [more]
PDI_RICCO6.322e-2931.34Protein disulfide-isomerase OS=Ricinus communis PE... [more]
PDI_MAIZE8.257e-2930.61Protein disulfide-isomerase OS=Zea mays GN=PDI PE=... [more]
PDI_WHEAT1.408e-2829.22Protein disulfide-isomerase OS=Triticum aestivum G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900278 VSS Citrus sinensis cDNA clone VS28624 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900278 ID=DC900278|Name=DC900278|organism=Citrus sinensis|type=EST|length=1108bp
GTCAACTTCTATCAAACTACAAATCCTGATGTGGCAAAGATTTTCCACCT
TGATTCTGAAGTCAATCGCCCGGCTCTGGTCATGGTTAAGAAGGAGGCTG
AGAAAATAAGCTATTTTGATGGGAAATTTGATAAGTCTACTATTGCTGAT
TTTGTATTTTCAAACAAGCTTCCTTTAGTCACCATTTTTACAAGGGAAAA
TGCCCCTTCAGTTTTTGAAAGTCCAATTAAGAATCAGCTGCTATTGTTTG
CTGTTTCAAATGACTCAGAAAAGCTTTTACCAGTATTCGAAGAAGCCGCA
AAATCTTTCAAGGGAAAGCTTATTTTTGTGTATGTCCAAATGGACAATGA
AGATGTCGGAAAGCCTGTTTCAGAGTATTTTGGCATCACTGGGGAAGCTC
CCAAAGTTCTTGCATACACGGGGAATGATGACGCTAAAAAACATATCCTG
GATGGAGAGTTGACCTTGGATAAAATTAAGACTTTTGGAGAGGATTTCCT
CGCAGGCAAGGTTAAGCCTTTCTTTAAGTCTGATCCAATTCCAGAAACTA
ATGATGGAGATGTGAAAATAGTGGTTGGAAATAACTTTGATGAAATTGTC
TTGGATGAGTCAAAGGATGTTCTTCTGGAGATCTATGCCCCTTGGTGTGG
GCATTGCCAAGCCTTCGAGCCAACCTACAACAAACTGGCCAAACATCTAC
GTGGCGTTGATTCTATTGTTATCGCTAAGATGGATGGCACGACAAATGAA
CATCACAGGGCAAAGTCTGATGGATTCCCAACAATTCTTTTCTTCCCAGC
TGGAAACAAGAGTTTTGATCCTATCAATGTAGATGTTGACCGTACTGTGG
TGGCATTGTACAAGTTTCTTAAGAAAAATGCTTCAATCCCCTTTAAAATC
CAGAAGCCAACATCAGCACCCAAGACAGAGAAACCAGCTTCGGAACCAAA
AGCTGAGTCCTCGGATATCAAAGGGAGCCACGAGAGCAGTAGCGANAAAG
ATGTGAAGGACGAATTGTAACTTGCCTAAAACAAGGAAGATGATATACAA
CGGGTGTAATGCTAAANTTANTGTACACCTTTTATCAGTCATCAGGTACT
AGAAAGAA
back to top