DC900278

Overview
NameDC900278
Unique NameDC900278
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1108
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5649 contig Csv1_Contig5649:1..1108. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI_YEAST (Protein disulfide-isomerase OS=Saccharomyces cerevisiae GN=PDI1 PE=1 SV=2)

HSP 1 Score: 118.242 bits (295), Expect = 8.545e-26
Identity = 96/301 (31.89%), Postives = 146/301 (48.50%), Query Frame = 1
Query:  115 FDGKFDKSTIADF-VFSNKLPLVTI-FTRENAPSVFESPIKNQLLL-FAVSNDSEKL---LPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHI----------LDGELTLDK--IKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLA-KHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAES 960
            ++GK  K+ IAD  VF   L +  + +  E   SVF   +++ L L +   ND E+L    P+F E AK  +G + FV +  D    G+       +  + P    +   +D K  +          L  ++ L+   I++  +DFL G   P  KS  I E  D  V  +VG N DEIV D  KDVL+  YAPWCGHC+   PTY +LA  +      ++IAK+D T N+      +G+PTI+ +P G KS + +     R++ +L+ F+K+N        K       EK A E  A++
Sbjct:  216 YNGK--KADIADADVFEKWLQVEALPYFGEIDGSVFAQYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSI--DARKFGRHAGN-LNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIESLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGYPTIVLYPGGKKS-ESVVYQGSRSLDSLFDFIKENGHFDVD-GKALYEEAQEKAAEEADADA 509          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: BS2_TRYBB (Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.234e-24
Identity = 87/324 (26.85%), Postives = 160/324 (49.38%), Query Frame = 1
Query:   67 RPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAP--SVFESPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEA--PKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRA--KSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKI-QKPTSAPKTEKPASEPKAESSDIKGSHESSSXKDVKDEL 1017
            +P  ++V ++  +   +DG  +   + +F+  +++      T EN    SV + P+    ++      S +L     E  K  +  ++ ++V +       PV   FG+  +A  P  LA     +   H     +T + ++ F  +F AG+V+P  KS P+PE    D K  +     +  L   KD+L+  +APWCGHC+ F PT++K+AK     D +++A++D T N  + +      FPT+ F P G K   P+  + +R+   +Y+F++K+ +  FK+ +KP +   TE+  SE + +SS    S++S+     K +L
Sbjct:  187 KPETIVVYRKGGEKEVYDGPMEVEKLTEFLQISRVAFGGEITPENYQYYSVIKRPV-GWAMVKPNETASIELKESLTEVGKKMRSHMVVLWVNISKH----PVWRDFGVPEDAKYPAFLAIHWGANYL-HSTAEVVTRESLEKFILEFAAGRVEPTIKSLPVPEVETVDGKTTIVAKTMQKHLTSGKDMLILFFAPWCGHCKNFAPTFDKIAKEFDATD-LIVAELDATANYVNSSTFTVTAFPTVFFVPNGGK---PVVFEGERSFENVYEFVRKHVT-TFKVSEKPANV--TEEKKSEEENKSSKSNESNDSNESNVDKQDL 497          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDILT_MACFA (Protein disulfide-isomerase-like protein of the testis OS=Macaca fascicularis GN=PDILT PE=2 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 6.124e-24
Identity = 79/266 (29.70%), Postives = 130/266 (48.87%), Query Frame = 1
Query:   28 DVAKIFHLDSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEK---LLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITG-EAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETND-GDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNK 810
            D   +F     VNR  L+      ++++    +  K  + DFV          +  EN   ++E  I + +LLF VS  SE    ++  ++ A+K F+ K++F+ V  D E   + V EYF +T  + P V     + DA+  +   ++T + +K FG  FL+   K    S+ IP+  D G VK +VG NF+ +V D+ KDV +  YAPW   C+   P   +L +  +   +I+IAK+D T N+      D +P    FP  ++
Sbjct:  220 DSILVFKKGKIVNRQELINDSTNKQELN----RVIKQHLTDFVIE--------YNAENKDLIYELYIMSHMLLF-VSKSSESFGIIIQHYKLASKEFQNKILFILVNAD-EPRNRRVIEYFRVTEVDIPSVQILNLSSDARYKMPSDDITYENLKKFGRSFLSKNAKKHQSSEEIPKHWDQGLVKQLVGKNFNIVVFDKEKDVFVMFYAPWSKKCKMLFPLLEELGRKYQNHSTIIIAKIDITANDIQLVYLDRYPFFRLFPTDSQ 471          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDILT_HUMAN (Protein disulfide-isomerase-like protein of the testis OS=Homo sapiens GN=PDILT PE=1 SV=2)

HSP 1 Score: 110.923 bits (276), Expect = 1.364e-23
Identity = 78/266 (29.32%), Postives = 130/266 (48.87%), Query Frame = 1
Query:   28 DVAKIFHLDSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEK---LLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITG-EAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETND-GDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNK 810
            D   +F     VNR  L+      ++++    +  K  + DFV          +  EN   + E  I + +LLF VS  SE    ++  ++ A+K F+ K++F+ V  D    G+ V +YF +T  + P V     + DA+  +   ++T + +K FG  FL+        S+ IP+  D G VK +VG NF+ +V D+ KDV +  YAPW   C+   P   +L +  +   +I+IAK+D T N+      D +P    FP+G++
Sbjct:  220 DSVLVFKKGKIVNRQKLINDSTNKQELN----RVIKQHLTDFVIE--------YNTENKDLISELHIMSHMLLF-VSKSSESYGIIIQHYKLASKEFQNKILFILVDADEPRNGR-VFKYFRVTEVDIPSVQILNLSSDARYKMPSDDITYESLKKFGRSFLSKNATKHQSSEEIPKYWDQGLVKQLVGKNFNVVVFDKEKDVFVMFYAPWSKKCKMLFPLLEELGRKYQNHSTIIIAKIDVTANDIQLMYLDRYPFFRLFPSGSQ 471          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI_ALTAL (Protein disulfide-isomerase (Fragment) OS=Alternaria alternata PE=1 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 5.184e-23
Identity = 65/196 (33.16%), Postives = 102/196 (52.04%), Query Frame = 1
Query:  451 DGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDS----IVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINV----DVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAESSDIKGSHESSSXKDVKDE 1014
            + ++T  +I  F +DFLAGK+ P  KS+PIPE+NDG V +VV +N+ ++V+D  KDVL+E YAPWCGHC+A  P Y +L + L   D     + IAK+D T N+    +  GF     FP   +      +       R V    +  + +AS+   ++  T + K    ++   A S+  +G+    S   V  +
Sbjct:  201 EAKITEKEIGKFVDDFLAGKIDPSIKSEPIPESNDGPVTVVVAHNYKDVVIDNDKDVLVEFYAPWCGHCKALAPKYEELGQ-LYASDELSKLVTIAKVDATLND-VPDEIQGFLPSSLFPLARRMPQSTTLVPHCRGSRPVHRRERLTQASASVGEAVEDATESAKASASSATDSAASAVSEGTETVKSGASVASD 394          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: ERP60_SCHMA (Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 6.770e-23
Identity = 72/206 (34.95%), Postives = 110/206 (53.40%), Query Frame = 1
Query:  271 KLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNE-HHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNAS 885
            ++L   ++  + FK  L+F Y   D  D    +S+Y GI  EA K+ A       KK+ L+ + +LD    F   F  G + P  KS+P+P  +   VK +V  NFDEIV +E KDV++  +A WCGHC+   P Y + A  ++   ++V+A MD T N+     +  GFPTI F P G KS  P++ +  R    + K+L + A+
Sbjct:  270 RVLKTLKDNPQKFKN-LVFAYSFAD--DFSYEISDY-GI--EADKLPAVVIQSKDKKYKLE-KFSLDAFSDFLNKFEDGLLTPHVKSEPLPTDDSSAVKKLVALNFDEIVNNEEKDVMVVFHAGWCGHCKNLMPKYEEAASKVKNEPNLVLAAMDATANDVPSPYQVRGFPTIYFVPKGKKS-SPVSYEGGRDTNDIIKYLAREAT 467          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDILT_RAT (Protein disulfide-isomerase-like protein of the testis OS=Rattus norvegicus GN=Pdilt PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 3.360e-22
Identity = 70/239 (29.29%), Postives = 118/239 (49.37%), Query Frame = 1
Query:  187 FTRENAPSVFESPIKNQLLLFAVSNDSEKLLPV---FEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITG-EAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGD-VKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASI 888
            F  EN   ++E  I N +LLF +S +SE    +   + + +K F+ K++FV V  D E   K + EYF I+    P V     + DA+  +    +T + +K F   FL+   K    S+ IP+  D + VK +VG NF+ +V D+ KDV +  YAPW   C+   P   +L    +   +++IAK+D T N+   A  + +P    FP  ++  + +    + T+     FL+ +  +
Sbjct:  258 FNPENKDLIYEMNILNHMLLF-ISKNSEPYSTIIRHYRQISKEFQNKILFVLVNSD-EPKNKRIFEYFQISRVNVPSVQILNLSSDARYKMPTDNITFESLKKFCNSFLSRTAKKHKSSEEIPKYWDQEPVKKLVGKNFNVVVFDKEKDVFVMFYAPWSEKCRVLLPLLEELGIKYQNHSTVIIAKIDITANDIQLANPEQYPFFRLFPTDSQ--EAVMYKGEHTMKGFCDFLESHVKV 492          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDILT_MOUSE (Protein disulfide-isomerase-like protein of the testis OS=Mus musculus GN=Pdilt PE=1 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 5.732e-22
Identity = 70/236 (29.66%), Postives = 116/236 (49.15%), Query Frame = 1
Query:  196 ENAPSVFESPIKNQLLLFAVSNDSEKLLPV---FEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITG-EAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETND-GDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASI 888
            EN   ++E  I N +LLF +S  SE    +   + + AK F+ K++FV V  D E   K + EYF I+    P V     + D +  +   ++  + +K F   FL+   K    S+ IP+  D G VK +VG NF+ +VLD+ KDV +  YAPW   C+   P   +L    +   +++IAK+D T N+   A  + +P    FP  ++  + +    + T+     FL+ +  +
Sbjct:  261 ENKDLIYELNILNHMLLF-ISKSSEPYSTISRHYRQIAKEFQNKILFVLVNAD-EPKNKRIFEYFQISRVNVPSVQILNLSSDGRYKMPTDDINFESLKKFCNSFLSKTAKKHKASEEIPKYWDQGPVKKLVGKNFNVVVLDKEKDVFVMFYAPWSEKCRVLLPLLEELGIKYQNHSTVIIAKIDITANDIQLANPEQYPFFRLFPTDSQ--EAVMYKGEHTMKGFCDFLESHVKV 492          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA6_MEDSA (Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 5.931e-19
Identity = 70/219 (31.96%), Postives = 103/219 (47.03%), Query Frame = 1
Query:  178 VTIFTRENAPSVFESPI---KNQLLLFAVS--NDSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSD--GFPTILFFPAGNKS 813
            V + T EN    FE  +   K  L+ F        +KL P +E+   SFK     +  ++D ++  K V   +G++G         G+ + KK   +G  T + +  F        VK          T    V ++    F+E+VLD +KDVL+E YAPWCGHC++  P Y K+A   +  D +VIA +D         K D  GFPT+ FFP GNK+
Sbjct:   31 VVVLTEEN----FEKEVGHDKGALVEFYAPWCGHCKKLAPEYEKLPNSFKKAKSVLIAKVDCDE-HKSVCSKYGVSGYPTIQWFPKGSLEPKK--FEGPRTAESLAEFVNTEGGTNVKI--------ATAPSHVVVLTPETFNEVVLDGTKDVLVEFYAPWCGHCKSLAPIYEKVAAVFKSEDDVVIANLDADKYRDLAEKYDVSGFPTLKFFPKGNKA 234          

HSP 2 Score: 72.7886 bits (177), Expect = 4.117e-12
Identity = 43/118 (36.44%), Postives = 61/118 (51.69%), Query Frame = 1
Query:  559 DVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKS----DGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKI 900
            DV ++   NF++ V    K  L+E YAPWCGHC+   P Y KL    +   S++IAK+D   +EH    S     G+PTI +FP G  S +P   +  RT  +L +F+        KI
Sbjct:   30 DVVVLTEENFEKEV-GHDKGALVEFYAPWCGHCKKLAPEYEKLPNSFKKAKSVLIAKVD--CDEHKSVCSKYGVSGYPTIQWFPKG--SLEPKKFEGPRTAESLAEFVNTEGGTNVKI 142          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: EUG1_YEAST (Protein disulfide-isomerase EUG1 OS=Saccharomyces cerevisiae GN=EUG1 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 7.746e-19
Identity = 79/297 (26.60%), Postives = 132/297 (44.44%), Query Frame = 1
Query:   49 LDSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTI-FTRENAPSVFESPIKNQLLL----FAVSNDSEKLLPVFEEAAKSFKGKLIFV---------YVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRG----VDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNAS 885
            LDSE ++   + +    E I  FDG  D         +  L +V + +  +  P +F   I + L L    +    + E    +F +  K  +G++ F+         +V+  N     P+     +       L     ++  K      L  D I    +D+  G  KP  KS+ IP+    +V  +VG   D+IV D+ KDVL++ YA WC H + F P Y ++A  L       D I+IA++D   N+       G+PTI  +PAGN S  PI  +  R +  +++F+K++ +
Sbjct:  194 LDSE-DKSLSIHLPNTTEPI-LFDGNVDSLVGNSVALTQWLKVVILPYFTDIEPDLFPKYISSNLPLAYFFYTSEEELEDYTDLFTQLGKENRGQINFIALNSTMFPHHVRFLNMREQFPLFAIHNMINNLKYGLPQLPEEEYAKLEKPQPLDRDMIVQLVKDYREGTAKPIVKSEEIPKEQKSNVYKIVGKTHDDIVHDDDKDVLVKYYATWCIHSKRFAPIYEEIANVLASDESVRDKILIAEVDSGANDILSFPVTGYPTIALYPAGNNS-KPIIFNKIRNLEDVFEFIKESGT 487          
The following BLAST results are available for this feature:
BLAST of DC900278 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
PDI_YEAST8.545e-2631.89Protein disulfide-isomerase OS=Saccharomyces cerev... [more]
BS2_TRYBB1.234e-2426.85Bloodstream-specific protein 2 OS=Trypanosoma bruc... [more]
PDILT_MACFA6.124e-2429.70Protein disulfide-isomerase-like protein of the te... [more]
PDILT_HUMAN1.364e-2329.32Protein disulfide-isomerase-like protein of the te... [more]
PDI_ALTAL5.184e-2333.16Protein disulfide-isomerase (Fragment) OS=Alternar... [more]
ERP60_SCHMA6.770e-2334.95Probable protein disulfide-isomerase ER-60 OS=Schi... [more]
PDILT_RAT3.360e-2229.29Protein disulfide-isomerase-like protein of the te... [more]
PDILT_MOUSE5.732e-2229.66Protein disulfide-isomerase-like protein of the te... [more]
PDIA6_MEDSA5.931e-1931.96Probable protein disulfide-isomerase A6 OS=Medicag... [more]
EUG1_YEAST7.746e-1926.60Protein disulfide-isomerase EUG1 OS=Saccharomyces ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900278 VSS Citrus sinensis cDNA clone VS28624 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900278 ID=DC900278|Name=DC900278|organism=Citrus sinensis|type=EST|length=1108bp
GTCAACTTCTATCAAACTACAAATCCTGATGTGGCAAAGATTTTCCACCT
TGATTCTGAAGTCAATCGCCCGGCTCTGGTCATGGTTAAGAAGGAGGCTG
AGAAAATAAGCTATTTTGATGGGAAATTTGATAAGTCTACTATTGCTGAT
TTTGTATTTTCAAACAAGCTTCCTTTAGTCACCATTTTTACAAGGGAAAA
TGCCCCTTCAGTTTTTGAAAGTCCAATTAAGAATCAGCTGCTATTGTTTG
CTGTTTCAAATGACTCAGAAAAGCTTTTACCAGTATTCGAAGAAGCCGCA
AAATCTTTCAAGGGAAAGCTTATTTTTGTGTATGTCCAAATGGACAATGA
AGATGTCGGAAAGCCTGTTTCAGAGTATTTTGGCATCACTGGGGAAGCTC
CCAAAGTTCTTGCATACACGGGGAATGATGACGCTAAAAAACATATCCTG
GATGGAGAGTTGACCTTGGATAAAATTAAGACTTTTGGAGAGGATTTCCT
CGCAGGCAAGGTTAAGCCTTTCTTTAAGTCTGATCCAATTCCAGAAACTA
ATGATGGAGATGTGAAAATAGTGGTTGGAAATAACTTTGATGAAATTGTC
TTGGATGAGTCAAAGGATGTTCTTCTGGAGATCTATGCCCCTTGGTGTGG
GCATTGCCAAGCCTTCGAGCCAACCTACAACAAACTGGCCAAACATCTAC
GTGGCGTTGATTCTATTGTTATCGCTAAGATGGATGGCACGACAAATGAA
CATCACAGGGCAAAGTCTGATGGATTCCCAACAATTCTTTTCTTCCCAGC
TGGAAACAAGAGTTTTGATCCTATCAATGTAGATGTTGACCGTACTGTGG
TGGCATTGTACAAGTTTCTTAAGAAAAATGCTTCAATCCCCTTTAAAATC
CAGAAGCCAACATCAGCACCCAAGACAGAGAAACCAGCTTCGGAACCAAA
AGCTGAGTCCTCGGATATCAAAGGGAGCCACGAGAGCAGTAGCGANAAAG
ATGTGAAGGACGAATTGTAACTTGCCTAAAACAAGGAAGATGATATACAA
CGGGTGTAATGCTAAANTTANTGTACACCTTTTATCAGTCATCAGGTACT
AGAAAGAA
back to top