DC900274

Overview
NameDC900274
Unique NameDC900274
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length779
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODP2_RICCN (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia conorii GN=pdhC PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.879e-19
Identity = 49/97 (50.52%), Postives = 68/97 (70.10%), Query Frame = 3
Query:   57 HQLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            ++L P++++GG       G +GIK F AIINPPQS I+ VG++ KR I  +  DQ   ++ M VTLS DHRV+DGA+GAE+L AFK +IE+P  ML+
Sbjct:  318 NKLTPEEFQGGGFTISNLGMYGIKNFNAIINPPQSCIMGVGASAKRAI--VKNDQITIATIMDVTLSADHRVVDGAVGAEFLVAFKKFIESPVLMLI 412          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODP2_ZYMMO (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Zymomonas mobilis GN=pdhC PE=3 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 3.810e-18
Identity = 48/104 (46.15%), Postives = 68/104 (65.38%), Query Frame = 3
Query:   33 QTVAQKPXHQLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESML 344
            + +A+    +L+PQ+Y+GGTS     G FGIKQF A+INPPQ+ ILA+GS E+R  P +  D    ++  ++T S DHRVIDGA  A ++ AFK  +E P  +L
Sbjct:  337 ELIARAREGRLQPQEYQGGTSSISNMGMFGIKQFNAVINPPQASILAIGSGERR--PWVIDDAITIATVATITGSFDHRVIDGADAAAFMSAFKHLVEKPLGIL 438          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODP2_RICPR (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia prowazekii GN=pdhC PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 5.502e-17
Identity = 48/97 (49.48%), Postives = 65/97 (67.01%), Query Frame = 3
Query:   57 HQLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            ++L P +++GG       G +GIK F AIIN PQS I+ VG++ KR I  +  DQ   ++ M VTLS DHRVIDGA+ AE+L +FK +IENP  ML+
Sbjct:  314 NKLTPIEFQGGGFTISNLGMYGIKNFNAIINTPQSCIMGVGASTKRAI--VKNDQIIIATIMDVTLSADHRVIDGAVSAEFLASFKRFIENPVLMLI 408          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODP2_RICTY (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia typhi GN=pdhC PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.601e-16
Identity = 47/97 (48.45%), Postives = 65/97 (67.01%), Query Frame = 3
Query:   57 HQLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            ++L P +++GG       G +GIK F AIIN PQS I+ VG++ KR I  +  DQ   ++ M VTLS DHRVIDGA+ AE+L +FK +IE+P  ML+
Sbjct:  310 NKLTPVEFQGGGFTISNLGMYGIKNFNAIINTPQSCIMGVGASTKRAI--VKNDQIIIATIMDVTLSADHRVIDGAVSAEFLASFKRFIEHPVLMLI 404          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODP2_SCHPO (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Schizosaccharomyces pombe GN=SPCC794.07 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.355e-15
Identity = 43/98 (43.88%), Postives = 63/98 (64.29%), Query Frame = 3
Query:   57 HQLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQ-YKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            ++L+P++Y+GGT      G F + QF AIINPPQ+ ILAVG+    V+P    ++ +K +  M  TLS DHRV+DGA+ A +  A K  +ENP  ++L
Sbjct:  386 NKLKPEEYQGGTFTISNLGMFPVDQFTAIINPPQACILAVGTTVDTVVPDSTSEKGFKVAPIMKCTLSSDHRVVDGAMAARFTTALKKILENPLEIML 483          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODP2_NEUCR (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Neurospora crassa GN=mrp-3 PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 6.726e-15
Identity = 44/100 (44.00%), Postives = 65/100 (65.00%), Query Frame = 3
Query:   60 QLEPQDYEGGT-SQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSF---MSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            +L+P++Y+GG+ S   +G    ++ F AIINPPQ+ ILAVG+ +K  +P    D     S+   + VT S DH+V+DGA+GAEW++  K  IENP  +LL
Sbjct:  359 KLKPEEYQGGSISISNMGMNPAVQSFTAIINPPQAAILAVGAPQKVAVPVENEDGTTGVSWDEQIIVTASFDHKVVDGAVGAEWIRELKKVIENPLELLL 458          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: OPD21_ARATH (Dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=LTA3 PE=1 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 1.147e-14
Identity = 42/99 (42.42%), Postives = 59/99 (59.60%), Query Frame = 3
Query:   60 QLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSF---MSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            +L P +++GGT      G + +  FCAIINPPQ+GILAVG   K V P +G D  +  S    M+VTLS DHR+ DG +GA ++   +   E+   +LL
Sbjct:  539 KLAPHEFQGGTFSISNLGMYPVDNFCAIINPPQAGILAVGRGNKVVEPVIGLDGIEKPSVVTKMNVTLSADHRIFDGQVGASFMSELRSNFEDVRRLLL 637          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODP2_YEAST (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Saccharomyces cerevisiae GN=PDA2 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 6.295e-13
Identity = 41/111 (36.94%), Postives = 65/111 (58.56%), Query Frame = 3
Query:   21 NAXSQTVAQKPXHQLEPQDYEGGTSQYQ-LGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQ-YKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            N   + V +   ++L P++++GGT     +G    +  F +IINPPQS ILA+ + E+  +     +  + F + +++T + DHR IDGA GAE++K  K  IENP  MLL
Sbjct:  372 NEIKELVKRARINKLAPEEFQGGTICISNMGMNNAVNMFTSIINPPQSTILAIATVERVAVEDAAAENGFSFDNQVTITGTFDHRTIDGAKGAEFMKELKTVIENPLEMLL 482          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODO2_RICPR (Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia prowazekii GN=sucB PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.025e-11
Identity = 40/96 (41.67%), Postives = 51/96 (53.12%), Query Frame = 3
Query:   60 QLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            +L   D  GGT     GG +G      IINPPQSGIL +   E+R +   G  + +    M + LS DHR+IDG  G  +L   K  IENPE +LL
Sbjct:  306 KLSMSDLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDG--KIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKNLIENPEKLLL 399          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODO2_RICTY (Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia typhi GN=sucB PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.645e-11
Identity = 40/96 (41.67%), Postives = 51/96 (53.12%), Query Frame = 3
Query:   60 QLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            +L   D  GGT     GG +G      IINPPQSGIL +   E+R +   G  + +    M + LS DHR+IDG  G  +L   K  IENPE +LL
Sbjct:  303 KLSISDLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDG--KIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKNLIENPEKLLL 396          
The following BLAST results are available for this feature:
BLAST of DC900274 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 23
Match NameE-valueIdentityDescription
ODP2_RICCN5.879e-1950.52Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_ZYMMO3.810e-1846.15Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_RICPR5.502e-1749.48Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_RICTY1.601e-1648.45Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_SCHPO1.355e-1543.88Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_NEUCR6.726e-1544.00Dihydrolipoyllysine-residue acetyltransferase comp... [more]
OPD21_ARATH1.147e-1442.42Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_YEAST6.295e-1336.94Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODO2_RICPR2.025e-1141.67Dihydrolipoyllysine-residue succinyltransferase co... [more]
ODO2_RICTY2.645e-1141.67Dihydrolipoyllysine-residue succinyltransferase co... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900274 VSS Citrus sinensis cDNA clone VS28618 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900274 ID=DC900274|Name=DC900274|organism=Citrus sinensis|type=EST|length=779bp
AGCTACAAAAAGGCTATCCCAATGCTAANAGTCAGACAGTGGCCCAAAAG
CCAAGNCACCAGCTTGAACCCCAAGATTATGAGGGAGGCACATCNCAGTA
CCAATTGGGAGGACCCTTCGGCATCAAGCAATTCTGTGCCATTATCAATC
CTCCTCAATCTGGCATTCTTGCAGTTGGATCTGCTGAGAAAAGGGTTATC
CCTGGCTTGGGTCCAGATCAGTATAAATTTTCTTCCTTCATGTCAGTAAC
ATTAAGTTGTGATCATCGCGTAATAGATGGTGCGATTGGTGCTGAATGGT
TGAAAGCATTCAAAGGATACATTGAGAATCCGGAGTCCATGTTGCTATAA
GCCAAACTTGTCTTTTTCTAAGTTGAGAAGCTCTTTCCTAGCTGTATCAG
TTTAGATGGGGGCTTCAGTTCAACCCCTTCCACCTGGGATCAGATTGGCA
TGGTTGTGTCACTGAGCACATCTTGATTTTGTTTTTCAATTGGTAAACAC
TTTTAAGCAAAAATTTTGGAATAAAAGCAGGGGATCGAGGCACGAAACCA
ATCCTTAAACTCATACTCATCCTTGATAGGGTGTTCAACAAGGTGNTCTG
CTATCGCCGTTTCCTTAATGGATTTTTGGGTTACATACGTGATGAACATG
ATTTTAGTAGAGTGTAATCGCCTCTTTCATGCGGGTAATAATTTGATTTA
TATATAATTTTTGGATTTTCCAATTACCAGTGTTGTGTGAAACAACACTT
ATATTAATTTGATAAACCTGTATTCTTGT
back to top