DC900270

Overview
NameDC900270
Unique NameDC900270
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length885
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:509..1393. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_ACICJ (Elongation factor Tu OS=Acidiphilium cryptum (strain JF-5) GN=tuf PE=3 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 1.035e-49
Identity = 96/155 (61.94%), Postives = 119/155 (76.77%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSI 470
            V++VGLK T   TVTGVEMF+K LD+  AGDN+G LLRG ++ D++RG VLA PG+ITPHT F   VY+L KEEGGRH+PFF  YRPQFY RTTDVTG V+       E  +MVMPGD + + VELI P+A ++G+RFAIREGG+TVG+GV+ SI
Sbjct:  244 VEIVGLKATVKTTVTGVEMFRKLLDQGEAGDNIGALLRGTKREDVERGQVLAAPGSITPHTNFSGSVYILNKEEGGRHTPFFTNYRPQFYFRTTDVTGVVT-----LPEGVEMVMPGDNVTVSVELIAPIAMDEGLRFAIREGGRTVGSGVVASI 393          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU1_STRAW (Elongation factor Tu 1 OS=Streptomyces avermitilis GN=tuf1 PE=3 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 1.035e-49
Identity = 96/157 (61.15%), Postives = 122/157 (77.71%), Query Frame = 3
Query:    3 TVDLVGLK-ETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSI 470
            TVD+VG+K E    TVTG+EMF+K LDE  AG+NVGLLLRG+++ D++RG V+ KPG++TPHT+F A  Y+L K+EGGRH+PFF  YRPQFY RTTDVTG V+       E ++MVMPGD  +M VELI PVA E+G++FAIREGG+TVGAG +  I
Sbjct:  244 TVDIVGIKTEKTTTTVTGIEMFRKLLDEGQAGENVGLLLRGIKREDVERGQVIIKPGSVTPHTEFEAQAYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGVVT-----LPEGTEMVMPGDNTEMTVELIQPVAMEEGLKFAIREGGRTVGAGQVTKI 395          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_MYCS5 (Elongation factor Tu OS=Mycoplasma synoviae (strain 53) GN=tuf PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.352e-49
Identity = 93/157 (59.24%), Postives = 122/157 (77.71%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VGLK T+   VTG+EMF+K L EA+AGDN GLLLRGV + D++RG VLAKPG+I PHT+F A +YVLKKEEGGRH+PFF  Y+PQFY RTTDVTG V     + +   +MVMPG+ + + V+LI P+A E+G +F+IREGG+TVGAG +  I++
Sbjct:  243 VEIVGLKPTKKTVVTGIEMFRKNLKEALAGDNAGLLLRGVNRDDVERGQVLAKPGSIVPHTEFEAAIYVLKKEEGGRHTPFFKNYKPQFYFRTTDVTGGV-----EFEAGREMVMPGENVNLKVKLISPIAVEEGTKFSIREGGRTVGAGSVTKIVK 394          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_METSB (Elongation factor Tu OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=tuf PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.352e-49
Identity = 95/157 (60.51%), Postives = 119/157 (75.80%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            +++VGLK T    VTGVEMF+K LD+  AGDN+G LLRG ++ D++RG VL KPG++ PHTKF A  Y+L K+EGGRH+PFF  YRPQFY RTTDVTG V+       E ++MVMPGD + M VELI P+A E+ +RFAIREGG+TVGAGV+ SI E
Sbjct:  245 IEIVGLKPTVKTVVTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQVLCKPGSVKPHTKFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGVVT-----LPEGTEMVMPGDNVTMDVELIAPIAMEEKLRFAIREGGRTVGAGVVASITE 396          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_JANSC (Elongation factor Tu OS=Jannaschia sp. (strain CCS1) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.352e-49
Identity = 95/157 (60.51%), Postives = 117/157 (74.52%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            + +VG+++T   T TGVEMF+K LD   AGDN+G LLRGV +  ++RG VL KPG++ PHTKF A  Y+L KEEGGRH+PFFA YRPQFY RTTDVTG V     +    ++MVMPGD +K  VELI P+A E G+RFAIREGG+TVGAGV+  IIE
Sbjct:  240 ISIVGIRDTTKTTCTGVEMFRKLLDRGEAGDNIGALLRGVDREGVERGQVLCKPGSVDPHTKFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTV-----NLPAGTEMVMPGDNLKFEVELIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE 391          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_FUSNN (Elongation factor Tu OS=Fusobacterium nucleatum subsp. nucleatum GN=tuf PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.352e-49
Identity = 94/155 (60.65%), Postives = 118/155 (76.13%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSI 470
            +++VG+K T   T TGVEMF+K LD+  AGDN+G+LLRG +K +++RG VLAKPG+I PHT F   VYVL K+EGGRH+PFF GYRPQFY RTTD+TG V+       +  +MVMPGD I M VELI P+A EQG+RFAIREGG+TV +GV+  I
Sbjct:  243 IEIVGIKPTTKTTCTGVEMFRKLLDQGQAGDNIGVLLRGTKKEEVERGQVLAKPGSIHPHTNFKGEVYVLTKDEGGRHTPFFTGYRPQFYFRTTDITGAVT-----LPDGVEMVMPGDNITMTVELIHPIAMEQGLRFAIREGGRTVASGVVSEI 392          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_DECAR (Elongation factor Tu OS=Dechloromonas aromatica (strain RCB) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.352e-49
Identity = 91/157 (57.96%), Postives = 120/157 (76.43%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            +++VG++ T     TGVEMF+K LD+  AGDN+G LLRG ++ D++RG VL KPG++ PHT F + VY+L K+EGGRH+PFF GYRPQFY RTTDVTG +     +  E ++MVMPGD I M ++LI P+A E+G+RFAIREGG+TVGAGV+  IIE
Sbjct:  245 IEIVGIRPTVKTICTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQVLCKPGSVKPHTHFTSEVYILSKDEGGRHTPFFNGYRPQFYFRTTDVTGSI-----ELPEGTEMVMPGDNIAMTIKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE 396          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_BRUSU (Elongation factor Tu OS=Brucella suis GN=tufA PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.352e-49
Identity = 94/157 (59.87%), Postives = 120/157 (76.43%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+K T   TVTGVEMF+K LD+  AGDN+G L+RGV + D++RG VL KPG++ PHTKF A  Y+L K+EGGRH+PFF  YRPQFY RTTDVTG V+         ++MVMPGD + M V LI+P+A E+ +RFAIREGG+TVGAG++ SIIE
Sbjct:  240 VEIVGIKATTKTTVTGVEMFRKLLDQGQAGDNIGALIRGVGREDVERGQVLCKPGSVKPHTKFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGVVT-----LPAGTEMVMPGDNVAMDVTLIVPIAMEEKLRFAIREGGRTVGAGIVSSIIE 391          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_BRUSI (Elongation factor Tu OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.352e-49
Identity = 94/157 (59.87%), Postives = 120/157 (76.43%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+K T   TVTGVEMF+K LD+  AGDN+G L+RGV + D++RG VL KPG++ PHTKF A  Y+L K+EGGRH+PFF  YRPQFY RTTDVTG V+         ++MVMPGD + M V LI+P+A E+ +RFAIREGG+TVGAG++ SIIE
Sbjct:  240 VEIVGIKATTKTTVTGVEMFRKLLDQGQAGDNIGALIRGVGREDVERGQVLCKPGSVKPHTKFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGVVT-----LPAGTEMVMPGDNVAMDVTLIVPIAMEEKLRFAIREGGRTVGAGIVSSIIE 391          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_BRUO2 (Elongation factor Tu OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.352e-49
Identity = 94/157 (59.87%), Postives = 120/157 (76.43%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+K T   TVTGVEMF+K LD+  AGDN+G L+RGV + D++RG VL KPG++ PHTKF A  Y+L K+EGGRH+PFF  YRPQFY RTTDVTG V+         ++MVMPGD + M V LI+P+A E+ +RFAIREGG+TVGAG++ SIIE
Sbjct:  240 VEIVGIKATTKTTVTGVEMFRKLLDQGQAGDNIGALIRGVGREDVERGQVLCKPGSVKPHTKFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGVVT-----LPAGTEMVMPGDNVAMDVTLIVPIAMEEKLRFAIREGGRTVGAGIVSSIIE 391          
The following BLAST results are available for this feature:
BLAST of DC900270 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_ACICJ1.035e-4961.94Elongation factor Tu OS=Acidiphilium cryptum (stra... [more]
EFTU1_STRAW1.035e-4961.15Elongation factor Tu 1 OS=Streptomyces avermitilis... [more]
EFTU_MYCS51.352e-4959.24Elongation factor Tu OS=Mycoplasma synoviae (strai... [more]
EFTU_METSB1.352e-4960.51Elongation factor Tu OS=Methylocella silvestris (s... [more]
EFTU_JANSC1.352e-4960.51Elongation factor Tu OS=Jannaschia sp. (strain CCS... [more]
EFTU_FUSNN1.352e-4960.65Elongation factor Tu OS=Fusobacterium nucleatum su... [more]
EFTU_DECAR1.352e-4957.96Elongation factor Tu OS=Dechloromonas aromatica (s... [more]
EFTU_BRUSU1.352e-4959.87Elongation factor Tu OS=Brucella suis GN=tufA PE=3... [more]
EFTU_BRUSI1.352e-4959.87Elongation factor Tu OS=Brucella suis (strain ATCC... [more]
EFTU_BRUO21.352e-4959.87Elongation factor Tu OS=Brucella ovis (strain ATCC... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900270 VSS Citrus sinensis cDNA clone VS28614 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900270 ID=DC900270|Name=DC900270|organism=Citrus sinensis|type=EST|length=885bp
AGACTGTTGATCTTGTGGGATTGAAGGAAACTAGGAATTTCACTGTAACT
GGGGTTGAAATGTTTCAAAAGACTCTAGACGAGGCAATGGCTGGGGATAA
TGTCGGGTTGTTACTTAGAGGTGTACAAAAGGCTGATATTCAGAGAGGGA
TGGTGTTGGCCAAGCCCGGAACAATTACTCCCCATACTAAGTTCCTTGCC
ATTGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCACCTTTCTT
TGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTGACTGGAA
GGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGATGGTTATG
CCTGGTGACCGTATCAAGATGGTTGTGGAGCTTATTATGCCAGTGGCTTG
TGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACTGTTGGAG
CTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACTTTCATGG
GCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCATATTCTT
AAGTTTTTATGGAATTAGTTTCACCATTCTAGGAACTTCCAGAACCTAAT
GTCATATAATTTGCAGTTTTGTTCTTATTTTGCATTGAACTCATGTCAAG
TCTAGTTGGAAAATGTTCATGTGATAATTCAATATGACTCACTTTTCCTC
AGTTGCTTCAGCTAATGTTGATTTGCCTGTGGTCAATATTTCAACATAAG
AAAGAAAAAGTTCTGGTATGTCTGATGGTGCTTATCAGCAACTTGTTATT
GTTTTCTAACTATGTTGAATATTGATAAAATATTTGTGGTTGGGTGCTCC
TTTTAGTTCAACCCAACTTATATTCATGGTTGAAT
back to top