DC900270

Overview
NameDC900270
Unique NameDC900270
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length885
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:509..1393. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_ASTLO (Elongation factor Tu, plastid OS=Astasia longa GN=tufA PE=3 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 3.793e-60
Identity = 107/158 (67.72%), Postives = 137/158 (86.71%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV+L+GLK  ++ T+TG+EMFQK+LDEA+AGDNVG+LLRG+QK +++RGMV+AKPGTI PH KF + VY+L KEEGGRH+PFF GY+PQFY+RTTDVTG++ S  +D     +MVMPGD+IKM+VEL+ P+A E+GMRFAIREGGKTVGAGVI +II+
Sbjct:  252 TVELIGLKNIKSTTITGLEMFQKSLDEAIAGDNVGVLLRGIQKNEVERGMVIAKPGTIQPHIKFNSQVYILTKEEGGRHTPFFEGYKPQFYVRTTDVTGKIESFKSDDGTTVQMVMPGDKIKMIVELVQPIAIEKGMRFAIREGGKTVGAGVIINIID 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_BIGNA (Elongation factor Tu, chloroplastic OS=Bigelowiella natans GN=tufA PE=3 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 6.469e-60
Identity = 107/157 (68.15%), Postives = 138/157 (87.90%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDE-ESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 473
            V++VGL+ETR+ TVTG+EMFQK L E++AGDNVG+LLRG+QKADIQRGMV+A+PG+ITPH  F A VY+L KEEGGRH+PFF GYRPQFY+RTTDVTG++ S+ +D+D  E +MV+PGDR+ M VEL+ P+A E+GMRFAIREGG+TVGAGV+ +++
Sbjct:  253 VEIVGLRETRSTTVTGLEMFQKMLQESIAGDNVGMLLRGIQKADIQRGMVVAQPGSITPHVSFDAQVYILTKEEGGRHTPFFKGYRPQFYVRTTDVTGKIESLKSDEDNTEMRMVVPGDRVTMSVELVQPIAIEKGMRFAIREGGRTVGAGVVSNVV 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_SYNS3 (Elongation factor Tu OS=Synechococcus sp. (strain CC9311) GN=tuf PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.103e-59
Identity = 111/157 (70.70%), Postives = 131/157 (83.44%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG++E R  TVTGVEMF+K LDE MAGDNVGLLLRG+QK DI+RGMVL KPG+ITPHTKF   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   +     +MVMPGD I+M  ELI PVA E GMRFAIREGG+T+GAGV+  IIE
Sbjct:  243 VEVVGIREPRKTTVTGVEMFRKLLDEGMAGDNVGLLLRGIQKEDIERGMVLVKPGSITPHTKFEGQVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTAEDGSNVEMVMPGDNIQMTGELICPVAMELGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PSEAK (Elongation factor Tu, chloroplastic OS=Pseudendoclonium akinetum GN=tufA PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.103e-59
Identity = 110/158 (69.62%), Postives = 132/158 (83.54%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV+++GL++T   TVTG+EMFQKTLDE +AGDNVG+LLRGVQK +IQRGMVLA PGTI PHTKF A VY+L KEEGGRH+PFF GYRPQFY+RTTDVTG++ S   D   E+ M   GDR+KMVVELI P+A E GMRFAIREGG+TVGAGV+ +I++
Sbjct:  252 TVEIIGLRDTTTTTVTGLEMFQKTLDETVAGDNVGVLLRGVQKDNIQRGMVLAAPGTIKPHTKFEAQVYILTKEEGGRHTPFFPGYRPQFYVRTTDVTGKIESFTADDGSEALMATSGDRLKMVVELIQPIAVENGMRFAIREGGRTVGAGVVSTILK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CYAP8 (Elongation factor Tu OS=Cyanothece sp. (strain PCC 8801) GN=tuf PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.103e-59
Identity = 109/158 (68.99%), Postives = 134/158 (84.81%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV++VG++ T + TVTGVEMFQKTL+E +AGDNVGLLLRGV+K DI+RGMV+AKPG+ITPHT+F   VYVL KEEGGRH+PFF  Y+PQFY+RTTDVTG +    +D+ E  +MVMPGDRIKM VELI P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  252 TVEIVGIRATSSTTVTGVEMFQKTLEEGLAGDNVGLLLRGVKKEDIERGMVIAKPGSITPHTQFEGEVYVLTKEEGGRHTPFFKNYKPQFYVRTTDVTGSIVDYTSDEGETVEMVMPGDRIKMTVELINPIAIEQGMRFAIREGGRTIGAGVVSKILK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_SYNS9 (Elongation factor Tu OS=Synechococcus sp. (strain CC9902) GN=tuf PE=3 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.441e-59
Identity = 110/157 (70.06%), Postives = 131/157 (83.44%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+++ R  TVTGVEMF+K LDE MAGDNVGLLLRG+QK DI+RGMVL KPG+ITPHTKF   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   +     +MVMPGD I+M  ELI PVA E GMRFAIREGG+T+GAGV+  IIE
Sbjct:  243 VEVVGIRDPRKTTVTGVEMFRKLLDEGMAGDNVGLLLRGIQKEDIERGMVLVKPGSITPHTKFEGQVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTAEDGSNVEMVMPGDNIQMTGELICPVAMEMGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PROMM (Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9313) GN=tuf PE=3 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.441e-59
Identity = 108/157 (68.79%), Postives = 132/157 (84.08%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            +++VG++++R  TVTGVEMF+K LDE +AGDN GLLLRG++K DI+RGMVL KPG+ITPHTKF   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   +     +MVMPGD IKM  ELI PVA EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  243 IEIVGIRDSRKTTVTGVEMFRKDLDEGLAGDNCGLLLRGIEKEDIERGMVLVKPGSITPHTKFEGQVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTAEDGSNVEMVMPGDNIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CYAP4 (Elongation factor Tu OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=tuf PE=3 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.441e-59
Identity = 109/158 (68.99%), Postives = 134/158 (84.81%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV++VG++ETR  TVTG+EMF+K+LDE MAGDN GLLLRG++K DI+RGMVLAKPG+ITPHT+F   VYVL ++EGGR +PFFAGYRPQFY+RTTDVTG + S   D    ++MVMPGDRIKM VELI P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  252 TVEVVGIRETRTTTVTGIEMFKKSLDEGMAGDNAGLLLRGLKKEDIERGMVLAKPGSITPHTEFEGEVYVLTEKEGGRKTPFFAGYRPQFYVRTTDVTGTIKSFTADDGSNAEMVMPGDRIKMNVELINPIAIEQGMRFAIREGGRTIGAGVVSKIVK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PROM3 (Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9303) GN=tuf PE=3 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 3.211e-59
Identity = 107/157 (68.15%), Postives = 132/157 (84.08%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            +++VG++++R  TVTGVEMF+K LDE +AGDN GLLLRG++K DI+RGMVL KPG+ITPHTKF   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   +     +MVMPGD IKM  ELI PVA EQGMRFAIREGG+T+GAGV+  II+
Sbjct:  243 IEIVGIRDSRKTTVTGVEMFRKDLDEGLAGDNCGLLLRGIEKEDIERGMVLVKPGSITPHTKFEGQVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTAEDGSNVEMVMPGDNIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIQ 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_MICAN (Elongation factor Tu OS=Microcystis aeruginosa (strain NIES-843) GN=tuf PE=3 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 7.153e-59
Identity = 108/157 (68.79%), Postives = 129/157 (82.17%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V+LVG++ETR  TVTG+EMF+K+LD+ MAGDN G+LLRG+QK DI+RGMV+AKPGTI PHT+F   VYVL KEEGGRH+PFF  YRPQFY+RTTDVTG +     D     +MVMPGDRIKM VELI P+A EQGMRFAIREGG+T+G+GVI  II+
Sbjct:  253 VELVGIRETRPTTVTGIEMFKKSLDQGMAGDNAGILLRGIQKTDIERGMVIAKPGTIKPHTQFEGEVYVLSKEEGGRHTPFFKNYRPQFYVRTTDVTGTIQDYTADDGSTVEMVMPGDRIKMTVELINPIAIEQGMRFAIREGGRTIGSGVISKIIK 409          
The following BLAST results are available for this feature:
BLAST of DC900270 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_ASTLO3.793e-6067.72Elongation factor Tu, plastid OS=Astasia longa GN=... [more]
EFTU_BIGNA6.469e-6068.15Elongation factor Tu, chloroplastic OS=Bigelowiell... [more]
EFTU_SYNS31.103e-5970.70Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_PSEAK1.103e-5969.62Elongation factor Tu, chloroplastic OS=Pseudendocl... [more]
EFTU_CYAP81.103e-5968.99Elongation factor Tu OS=Cyanothece sp. (strain PCC... [more]
EFTU_SYNS91.441e-5970.06Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_PROMM1.441e-5968.79Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_CYAP41.441e-5968.99Elongation factor Tu OS=Cyanothece sp. (strain PCC... [more]
EFTU_PROM33.211e-5968.15Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_MICAN7.153e-5968.79Elongation factor Tu OS=Microcystis aeruginosa (st... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900270 VSS Citrus sinensis cDNA clone VS28614 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900270 ID=DC900270|Name=DC900270|organism=Citrus sinensis|type=EST|length=885bp
AGACTGTTGATCTTGTGGGATTGAAGGAAACTAGGAATTTCACTGTAACT
GGGGTTGAAATGTTTCAAAAGACTCTAGACGAGGCAATGGCTGGGGATAA
TGTCGGGTTGTTACTTAGAGGTGTACAAAAGGCTGATATTCAGAGAGGGA
TGGTGTTGGCCAAGCCCGGAACAATTACTCCCCATACTAAGTTCCTTGCC
ATTGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCACCTTTCTT
TGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTGACTGGAA
GGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGATGGTTATG
CCTGGTGACCGTATCAAGATGGTTGTGGAGCTTATTATGCCAGTGGCTTG
TGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACTGTTGGAG
CTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACTTTCATGG
GCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCATATTCTT
AAGTTTTTATGGAATTAGTTTCACCATTCTAGGAACTTCCAGAACCTAAT
GTCATATAATTTGCAGTTTTGTTCTTATTTTGCATTGAACTCATGTCAAG
TCTAGTTGGAAAATGTTCATGTGATAATTCAATATGACTCACTTTTCCTC
AGTTGCTTCAGCTAATGTTGATTTGCCTGTGGTCAATATTTCAACATAAG
AAAGAAAAAGTTCTGGTATGTCTGATGGTGCTTATCAGCAACTTGTTATT
GTTTTCTAACTATGTTGAATATTGATAAAATATTTGTGGTTGGGTGCTCC
TTTTAGTTCAACCCAACTTATATTCATGGTTGAAT
back to top