DC900268

Overview
NameDC900268
Unique NameDC900268
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10954 contig Csv1_Contig10954:23..819. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYP3_CAEEL (Peptidyl-prolyl cis-trans isomerase 3 OS=Caenorhabditis elegans GN=cyn-3 PE=1 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 7.887e-67
Identity = 120/171 (70.18%), Postives = 136/171 (79.53%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M   KVFFD+T+GG+ +GRIVMEL+ DV P+TA NFRALCTGE GIGKSGKPLH+KGS FHR+IP FM Q            ESIYG KF DENF +KHTGPG+LSMANAGP TNGSQFF+CT KTEWLDGKHVVFG+VVEG+DVVKA+E  GS SG+  K  +IADCGQL
Sbjct:    1 MSRSKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQSGKPVKDCMIADCGQL 171          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYP7_CAEEL (Peptidyl-prolyl cis-trans isomerase 7 OS=Caenorhabditis elegans GN=cyn-7 PE=1 SV=2)

HSP 1 Score: 251.521 bits (641), Expect = 3.914e-66
Identity = 116/171 (67.84%), Postives = 134/171 (78.36%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M  P+VFFD+T+ G+P GRIVMEL+ D+ P+TAENFRALCTGEKG+GKSGKPLH+KGS FHR+IP FM Q            ESIYG KF DENF +KHTGPG+LSMANAGP TNGSQFF+CT KT WLDGKHVVFG+VVEG+D+V  +E  GSSSG      +IADCGQL
Sbjct:    1 MSRPRVFFDITIAGKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPEFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWLDGKHVVFGRVVEGLDIVSKVEGNGSSSGTPKSECLIADCGQL 171          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_DICDI (Peptidyl-prolyl cis-trans isomerase A OS=Dictyostelium discoideum GN=ppiA PE=1 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 6.677e-66
Identity = 120/169 (71.01%), Postives = 134/169 (79.29%), Query Frame = 3
Query:   51 NPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            NP+VFFD+T+GG  AG++VMEL+A+  P+TAENFRALCTGEKGIGKSGKPL YKGSSFHRVI  FMCQ            ESIYG+KFADENF  KH G G LSMANAG  TNGSQFF+C A T+WLDGKHVVFG V EGMDVVK +E  GS SG+T KPVVIA+CGQL
Sbjct:   11 NPRVFFDITIGGVEAGKVVMELYANTVPKTAENFRALCTGEKGIGKSGKPLSYKGSSFHRVITNFMCQGGDFTMGNGTGGESIYGNKFADENFKLKHFGQGTLSMANAGANTNGSQFFICVAPTDWLDGKHVVFGFVTEGMDVVKKMEAAGSQSGKTTKPVVIANCGQL 179          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYPH_ALLCE (Peptidyl-prolyl cis-trans isomerase OS=Allium cepa GN=CYP PE=2 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 2.537e-65
Identity = 120/151 (79.47%), Postives = 128/151 (84.77%), Query Frame = 3
Query:  108 MELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 560
            MELF DV P+TAENFRALCTGEKG+G   KPLHYKGSSFHRVIPGFMCQ            ESIYG+KF DENF+KKHTGPG+LSMANAGPGTNGSQFF+CT KT WLDGKHVVFGQVVEGMDVV+AIEKVGS SG+T KPV IADCGQLS
Sbjct:    1 MELFQDVVPQTAENFRALCTGEKGMGDR-KPLHYKGSSFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFKDENFIKKHTGPGVLSMANAGPGTNGSQFFICTEKTAWLDGKHVVFGQVVEGMDVVRAIEKVGSQSGQTKKPVKIADCGQLS 150          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYP2_CAEEL (Peptidyl-prolyl cis-trans isomerase 2 OS=Caenorhabditis elegans GN=cyn-2 PE=2 SV=2)

HSP 1 Score: 244.973 bits (624), Expect = 3.664e-64
Identity = 115/171 (67.25%), Postives = 132/171 (77.19%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            MP  KVFFD+T+GG+  GRIVMEL+ D+ P+TAENFRALCTGEKG GKSGK LH+KGS FHR+IP FM Q            ESI+G KF DENF +KHTGPG+LSMAN G  TNGSQFF+CT KT WLDGKHVVFG+V+EGMDVVKAIE  GS  G  + P VIADCG++
Sbjct:    1 MPRVKVFFDITIGGKKGGRIVMELYNDIVPKTAENFRALCTGEKGKGKSGKKLHFKGSKFHRIIPEFMIQGGDFTEGNGTGGESIHGEKFDDENFKEKHTGPGVLSMANCGANTNGSQFFLCTVKTTWLDGKHVVFGKVIEGMDVVKAIESKGSEDGAPSAPCVIADCGEM 171          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYP1_CAEEL (Peptidyl-prolyl cis-trans isomerase 1 OS=Caenorhabditis elegans GN=cyn-1 PE=2 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 2.626e-62
Identity = 113/168 (67.26%), Postives = 128/168 (76.19%), Query Frame = 3
Query:   54 PKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            PKVFFD+++G +PAGR+ MELF DV P+TAENFRALCTGEKG+G+ G  LH+KGS FHR+IP FM Q            ESIYG+KF DENF  KHTGPG LSMANAGP TNGSQFF+CT  T WLDG HVVFGQV +GM VVK IEK+GS SG   K V IADCG+L
Sbjct:   22 PKVFFDVSIGEEPAGRVTMELFNDVVPKTAENFRALCTGEKGVGEQGVALHFKGSKFHRIIPEFMIQGGDFTRHNGTGGESIYGNKFKDENFDLKHTGPGCLSMANAGPNTNGSQFFICTVDTPWLDGGHVVFGQVTDGMSVVKKIEKMGSRSGAPAKTVTIADCGEL 189          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_RAT (Peptidyl-prolyl cis-trans isomerase A OS=Rattus norvegicus GN=Ppia PE=1 SV=2)

HSP 1 Score: 238.424 bits (607), Expect = 3.429e-62
Identity = 113/171 (66.08%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+T  G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGSSFHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM +V+A+E+ GS +G+T+K + I+DCGQL
Sbjct:    1 MVNPTVFFDITADGEPLGRVCFELFADKVPKTAENFRALSTGEKGFG-------YKGSSFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMSIVEAMERFGSRNGKTSKKITISDCGQL 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIF_HUMAN (Peptidyl-prolyl cis-trans isomerase, mitochondrial OS=Homo sapiens GN=PPIF PE=1 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 5.849e-62
Identity = 115/178 (64.61%), Postives = 130/178 (73.03%), Query Frame = 3
Query:   27 PINQSKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 560
            P + S   NP V+ D+   G+P GR+V+EL ADV P+TAENFRALCTGEKG G       YKGS+FHRVIP FMCQ            +SIYGS+F DENF  KH GPG+LSMANAGP TNGSQFF+CT KT+WLDGKHVVFG V EGMDVVK IE  GS SGRT+K +VI DCGQLS
Sbjct:   37 PSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG-------YKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS 207          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_PONPY (Peptidyl-prolyl cis-trans isomerase A OS=Pongo pygmaeus GN=PPIA PE=2 SV=4)

HSP 1 Score: 237.269 bits (604), Expect = 7.639e-62
Identity = 113/171 (66.08%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + IADCGQL
Sbjct:    1 MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_PAPAN (Peptidyl-prolyl cis-trans isomerase A OS=Papio anubis GN=PPIA PE=2 SV=2)

HSP 1 Score: 237.269 bits (604), Expect = 7.639e-62
Identity = 113/171 (66.08%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + IADCGQL
Sbjct:    1 MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164          
The following BLAST results are available for this feature:
BLAST of DC900268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 232
Match NameE-valueIdentityDescription
CYP3_CAEEL7.887e-6770.18Peptidyl-prolyl cis-trans isomerase 3 OS=Caenorhab... [more]
CYP7_CAEEL3.914e-6667.84Peptidyl-prolyl cis-trans isomerase 7 OS=Caenorhab... [more]
PPIA_DICDI6.677e-6671.01Peptidyl-prolyl cis-trans isomerase A OS=Dictyoste... [more]
CYPH_ALLCE2.537e-6579.47Peptidyl-prolyl cis-trans isomerase OS=Allium cepa... [more]
CYP2_CAEEL3.664e-6467.25Peptidyl-prolyl cis-trans isomerase 2 OS=Caenorhab... [more]
CYP1_CAEEL2.626e-6267.26Peptidyl-prolyl cis-trans isomerase 1 OS=Caenorhab... [more]
PPIA_RAT3.429e-6266.08Peptidyl-prolyl cis-trans isomerase A OS=Rattus no... [more]
PPIF_HUMAN5.849e-6264.61Peptidyl-prolyl cis-trans isomerase, mitochondrial... [more]
PPIA_PONPY7.639e-6266.08Peptidyl-prolyl cis-trans isomerase A OS=Pongo pyg... [more]
PPIA_PAPAN7.639e-6266.08Peptidyl-prolyl cis-trans isomerase A OS=Papio anu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900268 VSS Citrus sinensis cDNA clone VS28611 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900268 ID=DC900268|Name=DC900268|organism=Citrus sinensis|type=EST|length=798bp
TCCGTGTTTAGTTTGTTTTTTTCTCTCCAATCAACCAATCAAAAATGCCA
AACCCCAAAGTGTTCTTCGACATGACCGTCGGCGGTCAGCCCGCCGGCAG
GATCGTGATGGAGCTCTTCGCCGATGTCACCCCCCGAACCGCCGAGAACT
TCCGCGCCCTCTGCACCGGCGAGAAAGGCATCGGCAAGTCCGGCAAGCCA
CTCCACTACAAGGGCTCGTCCTTCCACCGTGTGATCCCCGGATTCATGTG
CCAGGGGGGAGACTTCACCGCCGGAAACGGAACCGGAGGCGAATCAATCT
ACGGCTCAAAATTCGCCGATGAGAACTTCGTGAAGAAGCACACCGGCCCC
GGAATCCTCTCCATGGCGAATGCCGGACCCGGAACCAACGGATCTCAGTT
CTTCGTCTGTACGGCCAAGACCGAGTGGCTCGATGGGAAGCACGTTGTGT
TCGGTCAAGTCGTCGAAGGAATGGACGTCGTCAAGGCCATCGAGAAAGTG
GGGTCCAGCTCCGGAAGGACCAACAAGCCCGTCGTGATCGCTGATTGCGG
TCAATTGTCTTAGATTTGATCATGATAATGATCGCCATCATCACGAGCCG
TCTGATCGCGATCGTGATGGTGATTATGTTATCTATTATTATGTGGCCGT
GTCTGTAGGACTTTTAATCTTTATCTAATTTTCCTGCTATGGTACTTGGT
CGGGTTGGATCGGGTCTCCGGTGGTGGTTCTTGATGAACTGGTTTTTATG
GCTTTCTATGAGCTGCCTTTTAAATAAAAAAGGGCTTGCTTGTTTTTT
back to top