DC900268

Overview
NameDC900268
Unique NameDC900268
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10954 contig Csv1_Contig10954:23..819. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIL2_ASPFU (Peptidyl-prolyl cis-trans isomerase-like 2 OS=Aspergillus fumigatus GN=cyp8 PE=3 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 2.755e-11
Identity = 47/125 (37.60%), Postives = 60/125 (48.00%), Query Frame = 3
Query:   96 GRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADE-NFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVE 467
            G + +EL  +  P+   NF  L   +KG        +YK  +FHR I GFM Q            ESI+G  F DE     KH   G LSMAN G  TN SQFF+       L+ KH +FG V++
Sbjct:  322 GDVNLELHTEYAPKAVWNFIKLA--KKG--------YYKDVTFHRNIKGFMIQGGDPTGTGRGG-ESIWGKYFNDEFEGPLKHDSRGTLSMANKGKNTNSSQFFIAYRALPHLNNKHTIFGHVID 435          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIL2_EMENI (Peptidyl-prolyl cis-trans isomerase-like 2 OS=Emericella nidulans GN=cyp8 PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 4.700e-11
Identity = 48/126 (38.10%), Postives = 61/126 (48.41%), Query Frame = 3
Query:   93 AGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADE-NFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVE 467
            +G I +EL  +  P+   NF  L   +KG        +YK  +FHR I GFM Q            ESI+G  F DE     KH   G LSMAN G  TN SQFF+       L+ KH +FG V++
Sbjct:  319 SGDINLELHTEYAPKAVWNFIKLA--KKG--------YYKDVTFHRNIKGFMIQGGDPTGTGRGG-ESIWGKYFNDEFEGPLKHDSRGTLSMANKGKNTNSSQFFIAYRALPHLNLKHTIFGHVID 433          
The following BLAST results are available for this feature:
BLAST of DC900268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 232
Match NameE-valueIdentityDescription
PPIL2_ASPFU2.755e-1137.60Peptidyl-prolyl cis-trans isomerase-like 2 OS=Aspe... [more]
PPIL2_EMENI4.700e-1138.10Peptidyl-prolyl cis-trans isomerase-like 2 OS=Emer... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900268 VSS Citrus sinensis cDNA clone VS28611 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900268 ID=DC900268|Name=DC900268|organism=Citrus sinensis|type=EST|length=798bp
TCCGTGTTTAGTTTGTTTTTTTCTCTCCAATCAACCAATCAAAAATGCCA
AACCCCAAAGTGTTCTTCGACATGACCGTCGGCGGTCAGCCCGCCGGCAG
GATCGTGATGGAGCTCTTCGCCGATGTCACCCCCCGAACCGCCGAGAACT
TCCGCGCCCTCTGCACCGGCGAGAAAGGCATCGGCAAGTCCGGCAAGCCA
CTCCACTACAAGGGCTCGTCCTTCCACCGTGTGATCCCCGGATTCATGTG
CCAGGGGGGAGACTTCACCGCCGGAAACGGAACCGGAGGCGAATCAATCT
ACGGCTCAAAATTCGCCGATGAGAACTTCGTGAAGAAGCACACCGGCCCC
GGAATCCTCTCCATGGCGAATGCCGGACCCGGAACCAACGGATCTCAGTT
CTTCGTCTGTACGGCCAAGACCGAGTGGCTCGATGGGAAGCACGTTGTGT
TCGGTCAAGTCGTCGAAGGAATGGACGTCGTCAAGGCCATCGAGAAAGTG
GGGTCCAGCTCCGGAAGGACCAACAAGCCCGTCGTGATCGCTGATTGCGG
TCAATTGTCTTAGATTTGATCATGATAATGATCGCCATCATCACGAGCCG
TCTGATCGCGATCGTGATGGTGATTATGTTATCTATTATTATGTGGCCGT
GTCTGTAGGACTTTTAATCTTTATCTAATTTTCCTGCTATGGTACTTGGT
CGGGTTGGATCGGGTCTCCGGTGGTGGTTCTTGATGAACTGGTTTTTATG
GCTTTCTATGAGCTGCCTTTTAAATAAAAAAGGGCTTGCTTGTTTTTT
back to top