DC900268

Overview
NameDC900268
Unique NameDC900268
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10954 contig Csv1_Contig10954:23..819. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_PIG (Peptidyl-prolyl cis-trans isomerase A OS=Sus scrofa GN=PPIA PE=1 SV=2)

HSP 1 Score: 236.113 bits (601), Expect = 1.702e-61
Identity = 112/171 (65.50%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + IADCGQ+
Sbjct:    1 MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQI 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_BOVIN (Peptidyl-prolyl cis-trans isomerase A OS=Bos taurus GN=PPIA PE=1 SV=2)

HSP 1 Score: 236.113 bits (601), Expect = 1.702e-61
Identity = 112/171 (65.50%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + IADCGQ+
Sbjct:    1 MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQI 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIF_RAT (Peptidyl-prolyl cis-trans isomerase, mitochondrial OS=Rattus norvegicus GN=Ppif PE=1 SV=2)

HSP 1 Score: 235.343 bits (599), Expect = 2.903e-61
Identity = 114/174 (65.52%), Postives = 128/174 (73.56%), Query Frame = 3
Query:   39 SKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 560
            S   NP V+ D+   GQP GR+V+EL ADV P+TAENFRALCTGEKG G       YKGS+FHRVIP FMCQ            +SIYGS+F DENF  KH GPG+LSMANAGP TNGSQFF+CT KT+WLDGKHVVFG V EGMDVVK IE  GS SG+T+K +VI DCGQLS
Sbjct:   40 SSSQNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFG-------YKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQLS 206          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_SAGOE (Peptidyl-prolyl cis-trans isomerase A OS=Saguinus oedipus GN=PPIA PE=3 SV=3)

HSP 1 Score: 235.343 bits (599), Expect = 2.903e-61
Identity = 112/171 (65.50%), Postives = 130/171 (76.02%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CT KTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + IADCGQL
Sbjct:    1 MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTVKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_MOUSE (Peptidyl-prolyl cis-trans isomerase A OS=Mus musculus GN=Ppia PE=1 SV=2)

HSP 1 Score: 235.343 bits (599), Expect = 2.903e-61
Identity = 112/171 (65.50%), Postives = 130/171 (76.02%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+T   +P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGSSFHR+IPGFMCQ             SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + I+DCGQL
Sbjct:    1 MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_AOTTR (Peptidyl-prolyl cis-trans isomerase A OS=Aotus trivirgatus GN=PPIA PE=2 SV=3)

HSP 1 Score: 235.343 bits (599), Expect = 2.903e-61
Identity = 112/171 (65.50%), Postives = 130/171 (76.02%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CT KTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + IADCGQL
Sbjct:    1 MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTVKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIF_MOUSE (Peptidyl-prolyl cis-trans isomerase, mitochondrial OS=Mus musculus GN=Ppif PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.952e-61
Identity = 114/174 (65.52%), Postives = 127/174 (72.99%), Query Frame = 3
Query:   39 SKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 560
            S   NP V+ D+   GQP GR+V+EL ADV P+TAENFRALCTGEKG G       YKGS+FHRVIP FMCQ             SIYGS+F DENF  KH GPG+LSMANAGP TNGSQFF+CT KT+WLDGKHVVFG V EGMDVVK IE  GS SG+T+K +VI DCGQLS
Sbjct:   40 SSSGNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFG-------YKGSTFHRVIPAFMCQAGDFTNHNGTGGRSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQLS 206          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_BLAGE (Peptidyl-prolyl cis-trans isomerase OS=Blattella germanica GN=CYPA PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.952e-61
Identity = 113/171 (66.08%), Postives = 128/171 (74.85%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M +P+VFFDM+  GQP GRIVMEL +DV P+TAENFRALCTGEKG G       YKGS FHRVIP FMCQ            +SIYG+KF DENF  KHTGPGIL MANAGP TNGSQFF+ TAKT WLD +HVVFG VVEGMDVVK +E +GS SG+TNK + + DCGQ+
Sbjct:    1 MAHPRVFFDMSADGQPVGRIVMELRSDVVPKTAENFRALCTGEKGFG-------YKGSRFHRVIPNFMCQGGDFTNHNGTGGKSIYGTKFEDENFQLKHTGPGILWMANAGPNTNGSQFFITTAKTSWLDNRHVVFGSVVEGMDVVKKLESLGSQSGKTNKKIAVVDCGQI 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_FELCA (Peptidyl-prolyl cis-trans isomerase A OS=Felis catus GN=PPIA PE=2 SV=3)

HSP 1 Score: 233.802 bits (595), Expect = 8.446e-61
Identity = 111/171 (64.91%), Postives = 130/171 (76.02%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  +LFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG V EGM++V+A+E+ GS +G+T+K + IADCGQ+
Sbjct:    1 MVNPIVFFDIAVDGEPLGRVSFDLFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGMVKEGMNIVEAMERFGSRNGKTSKKITIADCGQI 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_RABIT (Peptidyl-prolyl cis-trans isomerase A OS=Oryctolagus cuniculus GN=PPIA PE=2 SV=3)

HSP 1 Score: 233.417 bits (594), Expect = 1.103e-60
Identity = 112/171 (65.50%), Postives = 129/171 (75.44%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM +V+A+E  GS +G+T+K + IA+CGQL
Sbjct:    1 MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFLLKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGRVKEGMSIVEAMEHFGSENGKTSKKITIANCGQL 164          
The following BLAST results are available for this feature:
BLAST of DC900268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 232
Match NameE-valueIdentityDescription
PPIA_PIG1.702e-6165.50Peptidyl-prolyl cis-trans isomerase A OS=Sus scrof... [more]
PPIA_BOVIN1.702e-6165.50Peptidyl-prolyl cis-trans isomerase A OS=Bos tauru... [more]
PPIF_RAT2.903e-6165.52Peptidyl-prolyl cis-trans isomerase, mitochondrial... [more]
PPIA_SAGOE2.903e-6165.50Peptidyl-prolyl cis-trans isomerase A OS=Saguinus ... [more]
PPIA_MOUSE2.903e-6165.50Peptidyl-prolyl cis-trans isomerase A OS=Mus muscu... [more]
PPIA_AOTTR2.903e-6165.50Peptidyl-prolyl cis-trans isomerase A OS=Aotus tri... [more]
PPIF_MOUSE4.952e-6165.52Peptidyl-prolyl cis-trans isomerase, mitochondrial... [more]
PPIA_BLAGE4.952e-6166.08Peptidyl-prolyl cis-trans isomerase OS=Blattella g... [more]
PPIA_FELCA8.446e-6164.91Peptidyl-prolyl cis-trans isomerase A OS=Felis cat... [more]
PPIA_RABIT1.103e-6065.50Peptidyl-prolyl cis-trans isomerase A OS=Oryctolag... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900268 VSS Citrus sinensis cDNA clone VS28611 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900268 ID=DC900268|Name=DC900268|organism=Citrus sinensis|type=EST|length=798bp
TCCGTGTTTAGTTTGTTTTTTTCTCTCCAATCAACCAATCAAAAATGCCA
AACCCCAAAGTGTTCTTCGACATGACCGTCGGCGGTCAGCCCGCCGGCAG
GATCGTGATGGAGCTCTTCGCCGATGTCACCCCCCGAACCGCCGAGAACT
TCCGCGCCCTCTGCACCGGCGAGAAAGGCATCGGCAAGTCCGGCAAGCCA
CTCCACTACAAGGGCTCGTCCTTCCACCGTGTGATCCCCGGATTCATGTG
CCAGGGGGGAGACTTCACCGCCGGAAACGGAACCGGAGGCGAATCAATCT
ACGGCTCAAAATTCGCCGATGAGAACTTCGTGAAGAAGCACACCGGCCCC
GGAATCCTCTCCATGGCGAATGCCGGACCCGGAACCAACGGATCTCAGTT
CTTCGTCTGTACGGCCAAGACCGAGTGGCTCGATGGGAAGCACGTTGTGT
TCGGTCAAGTCGTCGAAGGAATGGACGTCGTCAAGGCCATCGAGAAAGTG
GGGTCCAGCTCCGGAAGGACCAACAAGCCCGTCGTGATCGCTGATTGCGG
TCAATTGTCTTAGATTTGATCATGATAATGATCGCCATCATCACGAGCCG
TCTGATCGCGATCGTGATGGTGATTATGTTATCTATTATTATGTGGCCGT
GTCTGTAGGACTTTTAATCTTTATCTAATTTTCCTGCTATGGTACTTGGT
CGGGTTGGATCGGGTCTCCGGTGGTGGTTCTTGATGAACTGGTTTTTATG
GCTTTCTATGAGCTGCCTTTTAAATAAAAAAGGGCTTGCTTGTTTTTT
back to top