DC900268

Overview
NameDC900268
Unique NameDC900268
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10954 contig Csv1_Contig10954:23..819. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_HEMPU (Peptidyl-prolyl cis-trans isomerase OS=Hemicentrotus pulcherrimus PE=2 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.220e-59
Identity = 111/171 (64.91%), Postives = 126/171 (73.68%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M  P+VFFD+   G+  GRIVMEL ADV P+TAENFRALCTGEKG G       YKGS+FHRVIPGFMCQ            +SIYG KFADENF  KHT PGILSMANAG  TNGSQFF+CTA T WLDGKHVVFG V +G+D++K +E  GS SG+T+K + IADCGQL
Sbjct:    1 MAKPQVFFDLQANGENLGRIVMELRADVVPKTAENFRALCTGEKGFG-------YKGSTFHRVIPGFMCQGGDFTRHNGTGGKSIYGEKFADENFTLKHTQPGILSMANAGVNTNGSQFFICTAVTSWLDGKHVVFGAVTQGLDIIKKVESYGSDSGKTSKKITIADCGQL 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPI2_SYNY3 (Peptidyl-prolyl cis-trans isomerase slr1251 OS=Synechocystis sp. (strain PCC 6803) GN=slr1251 PE=3 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 3.549e-59
Identity = 107/167 (64.07%), Postives = 129/167 (77.25%), Query Frame = 3
Query:   57 KVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            KVFFD+T+G   AGRIVMELF +VTP+TAENFRALCTGEKG+GK+GKPLH+KGS FHRVI  FM Q            ESIYG KFADENF  KH  PG+LSMANAGP TNGSQFF+      WLDGKHVVFG+VVEG+++++ +E  GS SG+T + +VI+DCG++
Sbjct:    4 KVFFDITIGSDTAGRIVMELFDEVTPKTAENFRALCTGEKGVGKAGKPLHFKGSHFHRVITDFMAQGGDFTRGNGTGGESIYGEKFADENFQLKHDRPGLLSMANAGPNTNGSQFFLTFVPCPWLDGKHVVFGEVVEGLEILEQLEANGSQSGQTKQAIVISDCGEI 170          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CP19D_ARATH (Peptidyl-prolyl cis-trans isomerase CYP19-4 OS=Arabidopsis thaliana GN=CYP19-4 PE=1 SV=2)

HSP 1 Score: 224.557 bits (571), Expect = 5.124e-58
Identity = 107/167 (64.07%), Postives = 123/167 (73.65%), Query Frame = 3
Query:   57 KVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            KV+FD+ + G+ AGR+V+ LF    P+TAENFRALCTGEKG+GKSGKPLHYKGS FHR+IP FM Q            ESIYG KFADENF  KHTGPG+LSMAN+G  TNGSQFF+ T  T WLDG+HVVFG+VV+GMDVV  IE  G  SG     VVIAD G+L
Sbjct:   33 KVYFDVEIDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGVLSMANSGEDTNGSQFFITTVTTSWLDGRHVVFGKVVQGMDVVYKIEAEGKQSGTPKSKVVIADSGEL 199          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_DROME (Peptidyl-prolyl cis-trans isomerase OS=Drosophila melanogaster GN=Cyp1 PE=1 SV=2)

HSP 1 Score: 223.402 bits (568), Expect = 1.142e-57
Identity = 112/174 (64.37%), Postives = 127/174 (72.99%), Query Frame = 3
Query:   39 SKMPN-PKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            SKM   P+VFFDMT   +P GRIVMEL +DV P+TAENFRALCTGEKG G       YKGS FHRVIP FMCQ            +SIYG+KF DENF  KHTG GILSMANAG  TNGSQFF+CT KT WLD KHVVFG+VVEG+DVVK IE  GS SG+T+K +++A+ G L
Sbjct:   61 SKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFG-------YKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYP5_RHIOR (Peptidyl-prolyl cis-trans isomerase cyp5 OS=Rhizopus oryzae GN=cyp5 PE=3 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.947e-57
Identity = 104/168 (61.90%), Postives = 122/168 (72.62%), Query Frame = 3
Query:   54 PKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            PKVFFD+ V G+P+GR+  +LF+D  P+TAENFRALCTGEKG G SGKPLHYKGS FHR+IPGFM Q            ESIYG KF DENF  KHTG G+LSMANAGP TNGSQFF+   KT WLDG H VFGQ+VEG  V++ +E+ G+ SG     V I DCG++
Sbjct:    7 PKVFFDVAVNGKPSGRLTFKLFSDTVPKTAENFRALCTGEKGTGVSGKPLHYKGSHFHRIIPGFMAQGGDFTMGNGRGGESIYGHKFNDENFTLKHTGKGVLSMANAGPNTNGSQFFITFDKTPWLDGNHTVFGQLVEGNQVLEILEQHGTQSGMPTAKVEIVDCGEI 174          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYPX_USEUD (Peptidyl-prolyl cis-trans isomerase OS=Unspecified eudicot DB-1992 PE=2 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 4.338e-57
Identity = 115/168 (68.45%), Postives = 129/168 (76.79%), Query Frame = 3
Query:   63 FFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKP---VVIADCGQL 557
            FFDMT+GGQPAGRI+MELF DV P+TAENFRALCTGEKGIG SGK + Y+GS FHRVIP FM Q            ESIYG+KFADENF+ KHT PG+LSMANAGPGTNGSQFF+ T  T  LDGKHVVFG+VVEGMDVV+ IE   + + R +KP   V IA CGQL
Sbjct:    5 FFDMTIGGQPAGRIIMELFPDV-PKTAENFRALCTGEKGIGPSGKKMTYEGSVFHRVIPKFMLQGGDFTLGNGRGGESIYGAKFADENFIHKHTTPGLLSMANAGPGTNGSQFFITTVATPHLDGKHVVFGKVVEGMDVVRKIE--ATQTDRGDKPLSEVKIAKCGQL 169          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CP20A_ARATH (Peptidyl-prolyl cis-trans isomerase CYP20-1 OS=Arabidopsis thaliana GN=CYP20-1 PE=1 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.262e-56
Identity = 107/167 (64.07%), Postives = 120/167 (71.86%), Query Frame = 3
Query:   57 KVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            KV+FD+ + G+ AGRIVM LF    P+T ENFRALCTGEKGIGK+GK LHYKGSSFHR+IP FM Q            ESIYG KFADENF  KHTGPG LSMANAG  TNGSQFF+ T  T WLDG+HVVFG+VV GMDVV  +E  G+ SG     VVI D G+L
Sbjct:   36 KVYFDVEIDGKAAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKNGKALHYKGSSFHRIIPSFMLQGGDFTHGNGMGGESIYGEKFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWLDGRHVVFGKVVTGMDVVYKVEAEGNQSGTPKSKVVIVDSGEL 202          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPID_NEUCR (41 kDa peptidyl-prolyl cis-trans isomerase OS=Neurospora crassa GN=cyp-41 PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.648e-56
Identity = 108/179 (60.34%), Postives = 127/179 (70.95%), Query Frame = 3
Query:   24 SPINQSKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 560
            S  +  K    +VFFD+T+GG+ AGRIV EL+ D+ P+TAENFRALCTGEKG+GK GKPLHYKGS+FHRVI  FM Q            ESIYG+KF DENF  KH  P +LSMANAGPGTNGSQFFV T  T  LDGKHVVFG+V+ G  VV+ IE + +   +  K  VIADCG+LS
Sbjct:    2 SSTDDVKQARSRVFFDITIGGKAAGRIVFELYNDIVPKTAENFRALCTGEKGVGKLGKPLHYKGSTFHRVIKQFMIQGGDFTAGNGTGGESIYGAKFEDENFQLKHDRPFLLSMANAGPGTNGSQFFVTTVPTPHLDGKHVVFGEVLSGKSVVRQIENLKTQGDKPTKDAVIADCGELS 180          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIF_BOVIN (Peptidyl-prolyl cis-trans isomerase, mitochondrial OS=Bos taurus GN=PPIF PE=1 SV=2)

HSP 1 Score: 217.238 bits (552), Expect = 8.181e-56
Identity = 106/165 (64.24%), Postives = 120/165 (72.73%), Query Frame = 3
Query:   33 NQSKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNK 527
            + S   NP V+ D+   GQP GR+V+EL ADV P+TAENFRALCTGEKG G       YKGS+FHRVIP FMCQ            +SIYGS+F DENF  KH GPG+LSMANAGP TNGSQFF+CT KT+WLDGKHVVFG V EGMDVVK IE  GS SG+T+K
Sbjct:   40 SSSSSGNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFG-------YKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFKLKHEGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSK 197          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA1_RHIOR (Peptidyl-prolyl cis-trans isomerase A1 OS=Rhizopus oryzae GN=cyp2 PE=3 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.823e-55
Identity = 108/171 (63.16%), Postives = 122/171 (71.35%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NPKVFFD++   +P GRIVMEL ADV P+TAENFRALCTGEKG G       YKG SFHRVIP FM Q            +SIYG+KF DENF  KHTGPG LSMANAGP TNGSQFF+ T K  WLDGKHVVFG+V EGMDVV+ IE +GS +G     ++I +CGQL
Sbjct:    1 MSNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFG-------YKGCSFHRVIPEFMLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFFITTIKCSWLDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCGQL 164          
The following BLAST results are available for this feature:
BLAST of DC900268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 232
Match NameE-valueIdentityDescription
PPIA_HEMPU1.220e-5964.91Peptidyl-prolyl cis-trans isomerase OS=Hemicentrot... [more]
PPI2_SYNY33.549e-5964.07Peptidyl-prolyl cis-trans isomerase slr1251 OS=Syn... [more]
CP19D_ARATH5.124e-5864.07Peptidyl-prolyl cis-trans isomerase CYP19-4 OS=Ara... [more]
PPIA_DROME1.142e-5764.37Peptidyl-prolyl cis-trans isomerase OS=Drosophila ... [more]
CYP5_RHIOR1.947e-5761.90Peptidyl-prolyl cis-trans isomerase cyp5 OS=Rhizop... [more]
CYPX_USEUD4.338e-5768.45Peptidyl-prolyl cis-trans isomerase OS=Unspecified... [more]
CP20A_ARATH1.262e-5664.07Peptidyl-prolyl cis-trans isomerase CYP20-1 OS=Ara... [more]
PPID_NEUCR1.648e-5660.3441 kDa peptidyl-prolyl cis-trans isomerase OS=Neur... [more]
PPIF_BOVIN8.181e-5664.24Peptidyl-prolyl cis-trans isomerase, mitochondrial... [more]
PPIA1_RHIOR1.823e-5563.16Peptidyl-prolyl cis-trans isomerase A1 OS=Rhizopus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900268 VSS Citrus sinensis cDNA clone VS28611 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900268 ID=DC900268|Name=DC900268|organism=Citrus sinensis|type=EST|length=798bp
TCCGTGTTTAGTTTGTTTTTTTCTCTCCAATCAACCAATCAAAAATGCCA
AACCCCAAAGTGTTCTTCGACATGACCGTCGGCGGTCAGCCCGCCGGCAG
GATCGTGATGGAGCTCTTCGCCGATGTCACCCCCCGAACCGCCGAGAACT
TCCGCGCCCTCTGCACCGGCGAGAAAGGCATCGGCAAGTCCGGCAAGCCA
CTCCACTACAAGGGCTCGTCCTTCCACCGTGTGATCCCCGGATTCATGTG
CCAGGGGGGAGACTTCACCGCCGGAAACGGAACCGGAGGCGAATCAATCT
ACGGCTCAAAATTCGCCGATGAGAACTTCGTGAAGAAGCACACCGGCCCC
GGAATCCTCTCCATGGCGAATGCCGGACCCGGAACCAACGGATCTCAGTT
CTTCGTCTGTACGGCCAAGACCGAGTGGCTCGATGGGAAGCACGTTGTGT
TCGGTCAAGTCGTCGAAGGAATGGACGTCGTCAAGGCCATCGAGAAAGTG
GGGTCCAGCTCCGGAAGGACCAACAAGCCCGTCGTGATCGCTGATTGCGG
TCAATTGTCTTAGATTTGATCATGATAATGATCGCCATCATCACGAGCCG
TCTGATCGCGATCGTGATGGTGATTATGTTATCTATTATTATGTGGCCGT
GTCTGTAGGACTTTTAATCTTTATCTAATTTTCCTGCTATGGTACTTGGT
CGGGTTGGATCGGGTCTCCGGTGGTGGTTCTTGATGAACTGGTTTTTATG
GCTTTCTATGAGCTGCCTTTTAAATAAAAAAGGGCTTGCTTGTTTTTT
back to top