DC900206

Overview
NameDC900206
Unique NameDC900206
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length577
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900206 vs. ExPASy Swiss-Prot
Match: RSE1_SCHPO (Pre-mRNA-splicing factor rse1 OS=Schizosaccharomyces pombe GN=prp12 PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 4.327e-27
Identity = 59/124 (47.58%), Postives = 83/124 (66.94%), Query Frame = 3
Query:    3 MEEIVQFHVGDVVTSLQKASLVPGGGESVIYGTVMGSLGAMLAFSSRDDVDFFSHLEMHMRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLSLDLQRKIADELDRTPGEILKKLEEIR 374
            ++ +  F   D+ TSLQK  LV G  E +++  ++G++G    F +++DV FF  LE  +R+E PPL GRDH+AYRS Y PVK VIDGDLCE + +L   +Q  IA+ELDRT  E+ KK+E+ R
Sbjct: 1079 LDLMAHFFTNDIPTSLQKVQLVEGAREVLLWTGLLGTVGVFTPFINQEDVRFFQQLEFLLRKECPPLAGRDHLAYRSYYAPVKCVIDGDLCEMYYSLPHPVQEMIANELDRTIAEVSKKIEDFR 1202          
BLAST of DC900206 vs. ExPASy Swiss-Prot
Match: RSE1_EMENI (Pre-mRNA-splicing factor rse1 OS=Emericella nidulans GN=rse1 PE=3 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 8.161e-26
Identity = 58/120 (48.33%), Postives = 79/120 (65.83%), Query Frame = 3
Query:    3 MEEIVQFHVGDVVTSLQKASLVPGGGESVIYGTVMGSLGAMLAFSSRDDVDFFSHLEMHMRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLSLDLQRKIADELDRTPGEILKKL 362
            +E ++     D+ TSL K  LV GG + +++    G++G ++ F SR+DVDFF  LEM +  + PPL GRDH+ YRS Y PVK VIDGDLCEQ+  LS D +  IA ELDR+  EI +K+
Sbjct: 1081 LELMIHVFTQDIPTSLHKTQLVAGGRDILVWTGFQGTIGILVPFVSREDVDFFQSLEMQLASQCPPLAGRDHLIYRSYYAPVKGVIDGDLCEQYFLLSNDTKMMIAAELDRSVREIERKI 1200          
BLAST of DC900206 vs. ExPASy Swiss-Prot
Match: RSE1_ASPFU (Pre-mRNA-splicing factor rse1 OS=Aspergillus fumigatus GN=rse1 PE=3 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 9.023e-25
Identity = 55/120 (45.83%), Postives = 79/120 (65.83%), Query Frame = 3
Query:    3 MEEIVQFHVGDVVTSLQKASLVPGGGESVIYGTVMGSLGAMLAFSSRDDVDFFSHLEMHMRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLSLDLQRKIADELDRTPGEILKKL 362
            ++ ++  +  D+ TSL K  LV GG + +++    G++G ++ F SR+DVDFF +LEM +  + PPL GRDH+ YRS Y PVK VIDGDLCE +  L  D +  IA ELDR+  EI +K+
Sbjct: 1081 LDLMIHTYTQDIPTSLHKTQLVAGGRDILVWTGFQGTIGMLVPFVSREDVDFFQNLEMQLASQCPPLAGRDHLIYRSYYAPVKGVIDGDLCEMYFLLPNDTKMMIAAELDRSVREIERKI 1200          
BLAST of DC900206 vs. ExPASy Swiss-Prot
Match: RSE1_DEBHA (Pre-mRNA-splicing factor RSE1 OS=Debaryomyces hansenii GN=RSE1 PE=3 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 9.338e-22
Identity = 55/139 (39.57%), Postives = 86/139 (61.87%), Query Frame = 3
Query:    3 MEEIVQFHVGDVVTSLQKASLVPGGGESVIYGTVMGSLGAMLAFSSRDDVDFFSHLEMHMRQEHP-------------PLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLSLDLQRKIADELDRTPGEILKKLEEIRNK 380
            ++ I +F++ D+ TS  K SLV GG ES+IY  + G+LG +L  S+ ++V F   L++ +R+                 L G+DH+ +RS Y PVK+V+DGDL E+F  LS  ++ +I  EL+RTP EI KK+ E+R++
Sbjct: 1115 LKNICEFYLQDIPTSFTKGSLVMGGKESIIYTGIQGTLGLLLPLSTENEVKFLGDLQLLLRKYFDYNFDDFDKDKNGYNLLGKDHLKFRSYYNPVKNVMDGDLIERFYELSQSMKIRIGTELNRTPREIEKKISEMRHR 1253          
BLAST of DC900206 vs. ExPASy Swiss-Prot
Match: RSE1_CANAL (Pre-mRNA-splicing factor RSE1 OS=Candida albicans GN=RSE1 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.220e-21
Identity = 46/126 (36.51%), Postives = 84/126 (66.67%), Query Frame = 3
Query:    3 MEEIVQFHVGDVVTSLQKASLVPGGGESVIYGTVMGSLGAMLAFSSRDDVDFFSHLEMHMRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLSLDLQRKIADELDRTPGEILKKLEEIRNK 380
            ++ +++FH+GD++TS     L   G ESVIY  + G++G ++   S+ +V+   +L+++M+Q    L G+DH+  RS Y P+K+VIDGDL E+F    + L+ +I+ +L+++  +I KKL ++RN+
Sbjct: 1091 LQNLIEFHIGDIITSFNLGCLNLAGTESVIYTGLQGTIGLLIPLVSKSEVELLFNLQLYMQQSQNNLVGKDHLKLRSYYNPIKNVIDGDLLERFLEFDISLKIEISRKLNKSVNDIEKKLIDLRNR 1216          
The following BLAST results are available for this feature:
BLAST of DC900206 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
RSE1_SCHPO4.327e-2747.58Pre-mRNA-splicing factor rse1 OS=Schizosaccharomyc... [more]
RSE1_EMENI8.161e-2648.33Pre-mRNA-splicing factor rse1 OS=Emericella nidula... [more]
RSE1_ASPFU9.023e-2545.83Pre-mRNA-splicing factor rse1 OS=Aspergillus fumig... [more]
RSE1_DEBHA9.338e-2239.57Pre-mRNA-splicing factor RSE1 OS=Debaryomyces hans... [more]
RSE1_CANAL1.220e-2136.51Pre-mRNA-splicing factor RSE1 OS=Candida albicans ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900206 VSS Citrus sinensis cDNA clone VS28243 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900206 ID=DC900206|Name=DC900206|organism=Citrus sinensis|type=EST|length=577bp
AGATGGAGGAGATAGTACAGTTTCATGTTGGTGATGTGGTCACATCCTTG
CAGAAGGCATCCCTGGTTCCAGGTGGCGGGGAGAGTGTCATTTATGGAAC
AGTGATGGGTAGCTTGGGAGCTATGCTTGCATTTTCATCCCGTGATGATG
TTGACTTCTTTTCTCACCTTGAGATGCATATGAGGCAGGAACATCCACCT
TTATGTGGTCGTGATCACATGGCTTACAGATCAGCTTATTTCCCTGTTAA
GGACGTGATTGATGGGGATCTATGTGAGCAGTTCCCAACCCTGTCTTTAG
ATTTGCAAAGAAAAATTGCCGATGAATTGGATAGGACTCCTGGAGAGATC
CTCAAGAAACTTGAAGAAATCAGAAACAAGATCGTTTGAGAGAAGAAGAA
ACTATTTGGATGTAGCGTTTATTGTTGTTATTTTATTTGTTGTATATACG
GGCAGCAATCTTGTGATTTGCTAAAGTAGGATTTTAGCTTGTATTGTTGA
AATTTTTCTCAGTGTTCCTCTGTACTGCTACTTGGTACTCTTAACTAATG
CCGGAACCTGTTCAAGTGTCCTTCCTT
back to top