DC900201

Overview
NameDC900201
Unique NameDC900201
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length804
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5643 contig Csv1_Contig5643:1..805. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSP4_BRANA (Cysteine proteinase COT44 (Fragment) OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 6.360e-72
Identity = 128/207 (61.84%), Postives = 154/207 (74.40%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNPTGPS 636
            CGSCWAFST AAVEGIN I+T +LVSLSEQELVDCD   NQGCNGGLM+ AF+FI K GG+ TE  YPY   +G C+   ++S  V+IDG+E+VP+  E AL +AV+ QPVSVAIDAG   FQ Y  G+FTG+CGT ++H V AVGYG+  +G  YWIVRNSWG  WGE GYIRM+R ++ K G CGIA+EASYP+K S     G S
Sbjct:  121 CGSCWAFSTAAAVEGINKIVTGELVSLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPYHGTNGKCNSLLKNSRVVTIDGYEDVPSKDETALKRAVSYQPVSVAIDAGGRAFQHYQSGIFTGKCGTNMDHAVVAVGYGSE-NGVDYWIVRNSWGTRWGEDGYIRMERNVASKSGKCGIAIEASYPVKYSPNPVRGTS 326          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: GCP1_ARATH (Germination-specific cysteine protease 1 OS=Arabidopsis thaliana GN=GCP1 PE=2 SV=2)

HSP 1 Score: 266.544 bits (680), Expect = 1.199e-70
Identity = 127/200 (63.50%), Postives = 152/200 (76.00%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGI-SDKKGLCGIAMEASYPIKKS 612
            CGSCWAFST AAVEGIN I+T +L+SLSEQELVDCD   NQGCNGGLM+ AF+FI K GG+ TE  YPY+   G C+   ++S  VSIDG+E+VP   E AL KA++ QPVSVAI+AG   FQ Y  G+FTG CGT L+H V AVGYG+  +G  YWIVRNSWGP WGE+GYIRM+R + + K G CGIA+EASYP+K S
Sbjct:  166 CGSCWAFSTTAAVEGINKIVTGELISLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPYRGFGGKCNSFLKNSRVVSIDGYEDVPTKDETALKKAISYQPVSVAIEAGGRIFQHYQSGIFTGSCGTNLDHAVVAVGYGSE-NGVDYWIVRNSWGPRWGEEGYIRMERNLAASKSGKCGIAVEASYPVKYS 364          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: XCP2_ARATH (Xylem cysteine proteinase 2 OS=Arabidopsis thaliana GN=XCP2 PE=1 SV=2)

HSP 1 Score: 265.388 bits (677), Expect = 2.672e-70
Identity = 122/197 (61.93%), Postives = 152/197 (77.16%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIK 606
            CGSCWAFST+AAVEGIN I+T  L +LSEQEL+DCDT  N GCNGGLM+ AFE+I K GG+  E  YPY   +GTC++ K+ S  V+I+GH++VP N E +LLKA+A QP+SVAIDA   +FQFYS GVF G CG +L+HGVAAVGYG++  G+ Y IV+NSWGP+WGEKGYIR++R     +GLCGI   AS+P K
Sbjct:  159 CGSCWAFSTVAAVEGINKIVTGNLTTLSEQELIDCDTTYNNGCNGGLMDYAFEYIVKNGGLRKEEDYPYSMEEGTCEMQKDESETVTINGHQDVPTNDEKSLLKALAHQPLSVAIDASGREFQFYSGGVFDGRCGVDLDHGVAAVGYGSS-KGSDYIIVKNSWGPKWGEKGYIRLKRNTGKPEGLCGINKMASFPTK 354          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSPL_SOLLC (Low-temperature-induced cysteine proteinase (Fragment) OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 8.595e-69
Identity = 119/210 (56.67%), Postives = 153/210 (72.86%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNPTGPSDYP 645
            CGSCWAFS +AA+E IN I+T  L+SLSEQELVDCD   N+GC+GGLM+ AFEF+ K GG+ TE  YPY+  +G CD  ++++  V ID +E+VP N+E AL KAVA QPVS+A++AG  DFQ Y  G+FTG+CGT ++HGV   GYGT  +G  YWIVRNSWG    E GY+R+QR +S   GLCG+A+E SYP+ K+  NP  P+  P
Sbjct:   39 CGSCWAFSAVAAMESINAIVTGNLISLSEQELVDCDRSYNEGCDGGLMDYAFEFVIKNGGIDTEEDYPYKERNGVCDQYRKNAKVVKIDSYEDVPVNNEKALQKAVAHQPVSIALEAGGRDFQHYKSGIFTGKCGTAVDHGVVIAGYGTE-NGMDYWIVRNSWGANCRENGYLRVQRNVSSSSGLCGLAIEPSYPV-KTGPNPPKPAPSP 246          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: XCP1_ARATH (Xylem cysteine proteinase 1 OS=Arabidopsis thaliana GN=XCP1 PE=1 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 6.160e-67
Identity = 120/198 (60.61%), Postives = 147/198 (74.24%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIK 606
            +CGSCWAFST+AAVEGIN I T  L SLSEQEL+DCDT  N GCNGGLM+ AF++I   GG+  E  YPY   +G C   KE    V+I G+E+VP N +++L+KA+A QPVSVAI+A   DFQFY  GVF G+CGT+L+HGVAAVGYG++  G+ Y IV+NSWGP WGEKG+IRM+R     +GLCGI   ASYP K
Sbjct:  157 QCGSCWAFSTVAAVEGINQITTGNLSSLSEQELIDCDTTFNSGCNGGLMDYAFQYIISTGGLHKEDDYPYLMEEGICQEQKEDVERVTISGYEDVPENDDESLVKALAHQPVSVAIEASGRDFQFYKGGVFNGKCGTDLDHGVAAVGYGSS-KGSDYVIVKNSWGPRWGEKGFIRMKRNTGKPEGLCGINKMASYPTK 353          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CPR1_ARATH (Probable cysteine proteinase At3g19400 OS=Arabidopsis thaliana GN=At3g19400 PE=2 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 3.737e-64
Identity = 120/202 (59.41%), Postives = 143/202 (70.79%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTD-QNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQAND-GTCDVSKESSP-AVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKS 612
            CGSCWAFS + AVEGIN I T +L+SLSEQELVDCD    N GC+GG+M  AFEFI K GG+ T+  YPY AND G C+  K ++   V+IDG+E+VP + E +L KAVA QPVSVAI+A S  FQ Y  GV TG CG  L+HGV  VGYG+T  G  YWI+RNSWG  WG+ GY+++QR I D  G CGIAM  SYP K S
Sbjct:  151 CGSCWAFSAVGAVEGINQITTGELISLSEQELVDCDRGFVNAGCDGGIMNYAFEFIMKNGGIETDQDYPYNANDLGLCNADKNNNTRVVTIDGYEDVPRDDEKSLKKAVAHQPVSVAIEASSQAFQLYKSGVMTGTCGISLDHGVVVVGYGST-SGEDYWIIRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYPTKSS 351          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CPR3_ARATH (Probable cysteine proteinase At4g11310 OS=Arabidopsis thaliana GN=At4g11310 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 8.325e-64
Identity = 116/200 (58.00%), Postives = 149/200 (74.50%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVS-KESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKS 612
            C SCWAFST+ AVEG+N I+T +LV+LSEQ+L++C+ + N GC GG +E A+EFI K GG+ T+  YPY+A +G CD   KE++  V IDG+EN+PAN E AL+KAVA QPV+  ID+ S +FQ Y  GVF G CGT LNHGV  VGYGT  +G  YW+V+NS G  WGE GY++M R I++ +GLCGIAM ASYP+K S
Sbjct:  158 CRSCWAFSTVGAVEGLNKIVTGELVTLSEQDLINCNKENN-GCGGGKLETAYEFIMKNGGLGTDNDYPYKAVNGVCDGRLKENNKNVMIDGYENLPANDESALMKAVAHQPVTAVIDSSSREFQLYESGVFDGSCGTNLNHGVVVVGYGTE-NGRDYWLVKNSRGITWGEAGYMKMARNIANPRGLCGIAMRASYPLKNS 355          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CPR4_ARATH (Probable cysteine proteinase At4g11320 OS=Arabidopsis thaliana GN=At4g11320 PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.570e-62
Identity = 114/200 (57.00%), Postives = 147/200 (73.50%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVS-KESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKS 612
            C SCWAFST+ AVEG+N I+T +LV+LSEQ+L++C+ + N GC GG +E A+EFI   GG+ T+  YPY+A +G C+   KE +  V IDG+EN+PAN E AL+KAVA QPV+  +D+ S +FQ Y  GVF G CGT LNHGV  VGYGT  +G  YWIV+NS G  WGE GY++M R I++ +GLCGIAM ASYP+K S
Sbjct:  165 CRSCWAFSTVGAVEGLNKIVTGELVTLSEQDLINCNKENN-GCGGGKVETAYEFIMNNGGLGTDNDYPYKALNGVCEGRLKEDNKNVMIDGYENLPANDEAALMKAVAHQPVTAVVDSSSREFQLYESGVFDGTCGTNLNHGVVVVGYGTE-NGRDYWIVKNSRGDTWGEAGYMKMARNIANPRGLCGIAMRASYPLKNS 362          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CPGP2_ZINOF (Zingipain-2 OS=Zingiber officinale PE=1 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 2.051e-62
Identity = 114/198 (57.58%), Postives = 138/198 (69.70%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKK 609
            CGSCWAFST+AAVEGIN I+T  L+SLSEQ+LVDC T  N GC GG M  AF+FI   GG+ +E  YPY+  DG C+ S  ++P VSID +ENVP+++E +L KAVA QPVSV +DA   DFQ Y  G+FTG C    NH +  VGYGT  D   +WIV+NSWG  WGE GYIR +R I +  G CGI   ASYP+KK
Sbjct:   24 CGSCWAFSTVAAVEGINQIVTGDLISLSEQQLVDCTT-ANHGCRGGWMNPAFQFIVNNGGINSEETYPYRGQDGICN-STVNAPVVSIDSYENVPSHNEQSLQKAVANQPVSVTMDAAGRDFQLYRSGIFTGSCNISANHALTVVGYGTEND-KDFWIVKNSWGKNWGESGYIRAERNIENPDGKCGITRFASYPVKK 218          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: ERVB_TABDI (Ervatamin-B OS=Tabernaemontana divaricata PE=1 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 2.122e-59
Identity = 112/199 (56.28%), Postives = 135/199 (67.84%), Query Frame = 1
Query:   10 RECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIK 606
            ++CGSCWAFS +AAVE IN I T +L+SLSEQELVDCDT  + GCNGG M  AF++I   GG+ T+  YPY A  G+C   +     VSI+G + V  N+E AL  AVA QPVSV ++A  + FQ YS G+FTG CGT  NHGV  VGYGT   G  YWIVRNSWG  WG +GYI M+R ++   GLCGIA   SYP K
Sbjct:   20 KQCGSCWAFSAVAAVESINKIRTGQLISLSEQELVDCDT-ASHGCNGGWMNNAFQYIITNGGIDTQQNYPYSAVQGSCKPYRLR--VVSINGFQRVTRNNESALQSAVASQPVSVTVEAAGAPFQHYSSGIFTGPCGTAQNHGVVIVGYGTQ-SGKNYWIVRNSWGQNWGNQGYIWMERNVASSAGLCGIAQLPSYPTK 214          
The following BLAST results are available for this feature:
BLAST of DC900201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 179
Match NameE-valueIdentityDescription
CYSP4_BRANA6.360e-7261.84Cysteine proteinase COT44 (Fragment) OS=Brassica n... [more]
GCP1_ARATH1.199e-7063.50Germination-specific cysteine protease 1 OS=Arabid... [more]
XCP2_ARATH2.672e-7061.93Xylem cysteine proteinase 2 OS=Arabidopsis thalian... [more]
CYSPL_SOLLC8.595e-6956.67Low-temperature-induced cysteine proteinase (Fragm... [more]
XCP1_ARATH6.160e-6760.61Xylem cysteine proteinase 1 OS=Arabidopsis thalian... [more]
CPR1_ARATH3.737e-6459.41Probable cysteine proteinase At3g19400 OS=Arabidop... [more]
CPR3_ARATH8.325e-6458.00Probable cysteine proteinase At4g11310 OS=Arabidop... [more]
CPR4_ARATH1.570e-6257.00Probable cysteine proteinase At4g11320 OS=Arabidop... [more]
CPGP2_ZINOF2.051e-6257.58Zingipain-2 OS=Zingiber officinale PE=1 SV=1[more]
ERVB_TABDI2.122e-5956.28Ervatamin-B OS=Tabernaemontana divaricata PE=1 SV=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900201 VSS Citrus sinensis cDNA clone VS28238 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900201 ID=DC900201|Name=DC900201|organism=Citrus sinensis|type=EST|length=804bp
AATTCGGCACGAGAATGCGGTAGCTGCTGGGCTTTTTCAACAATTGCAGC
AGTAGAGGGCATTAATCACATTATGACAAATAAGCTCGTTTCTTTGTCTG
AGCAAGAGTTAGTTGATTGTGACACTGATCAAAACCAAGGATGTAATGGA
GGGCTAATGGAATTGGCATTTGAGTTCATCAAGAAAAAGGGTGGCGTAAC
AACAGAGGCTAAGTACCCTTACCAAGCTAATGATGGAACATGTGACGTTT
CAAAGGAAAGTTCCCCAGCAGTGTCAATTGACGGACATGAAAATGTACCT
GCTAATCACGAGGATGCTCTGCTTAAGGCAGTTGCAAAACAGCCTGTGTC
AGTAGCCATAGATGCCGGCAGTTCAGATTTCCAGTTCTATTCAGAGGGTG
TATTTACTGGAGAATGTGGCACAGAGCTGAATCATGGAGTTGCAGCTGTG
GGCTACGGTACAACACTCGATGGAACCAAGTATTGGATAGTGAGGAACTC
ATGGGGACCTGAATGGGGAGAGAAGGGTTACATCAGAATGCAGCGCGGCA
TCTCAGACAAAAAGGGACTCTGTGGTATTGCAATGGAAGCTTCATATCCC
ATCAAGAAATCTGCAACAAACCCAACAGGACCTTCAGATTATCCTAAGGA
TGAGCTCTAGACACGGTTCACTATTGTCTTTGGCTTTTCTCTGCATTTCA
AGCTCAGCGGTTATCTCTTCTGTGTTAAAGTTGCATGTAATATGCCCTTG
TGATTCATGATTGAATAATGTTTCGATTTATGCAAATAAAGCCAACATTT
TACA
back to top