DC900201

Overview
NameDC900201
Unique NameDC900201
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length804
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5643 contig Csv1_Contig5643:1..805. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: ACTN_ACTDE (Actinidain OS=Actinidia deliciosa PE=1 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 6.174e-59
Identity = 113/211 (53.55%), Postives = 139/211 (65.88%), Query Frame = 1
Query:    4 SARECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQN-QGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNPTGP 633
            S  ECG CWAFS IA VEGIN I+T  L+SLSEQEL+DC   QN +GCNGG +   F+FI   GG+ TE  YPY A DG C++  ++   V+ID +ENVP N+E AL  AV  QPVSVA+DA    F+ YS G+FTG CGT ++H V  VGYGT   G  YWIV+NSW   WGE+GY+R+ R +    G CGIA   SYP+K +  N   P
Sbjct:  144 SQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNLDLQNEKYVTIDTYENVPYNNEWALQTAVTYQPVSVALDAAGDAFKHYSSGIFTGPCGTAIDHAVTIVGYGTE-GGIDYWIVKNSWDTTWGEEGYMRILRNVGG-AGTCGIATMPSYPVKYNNQNHPKP 352          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: ACTN_ACTCH (Actinidain OS=Actinidia chinensis PE=1 SV=4)

HSP 1 Score: 227.639 bits (579), Expect = 6.174e-59
Identity = 114/211 (54.03%), Postives = 139/211 (65.88%), Query Frame = 1
Query:    4 SARECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQN-QGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNPTGP 633
            S  ECG CWAFS IA VEGIN I+T  L+SLSEQEL+DC   QN +GCNGG +   F+FI   GG+ TE  YPY A DG C+V  ++   V+ID +ENVP N+E AL  AV  QPVSVA+DA    F+ YS G+FTG CGT ++H V  VGYGT   G  YWIV+NSW   WGE+GY+R+ R +    G CGIA   SYP+K +  N   P
Sbjct:  144 SQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNVDLQNEKYVTIDTYENVPYNNEWALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAVDHAVTIVGYGTE-GGIDYWIVKNSWDTTWGEEGYMRILRNVGG-AGTCGIATMPSYPVKYNNQNHPKP 352          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CPGP1_ZINOF (Zingipain-1 OS=Zingiber officinale PE=1 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 3.064e-58
Identity = 109/198 (55.05%), Postives = 134/198 (67.68%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKK 609
            CGSCWAF  IAAVEGIN I+T  L+SLSEQ+LVDC T +N GC GG    AF++I   GG+ +E  YPY   +GTCD +KE++  VSID + NVP+N E +L KAVA QPVSV +DA   DFQ Y  G+FTG C    NH    VG   T +   YW V+NSWG  WGE GYIR++R I++  G CGIA+  SYPIK+
Sbjct:   24 CGSCWAFDAIAAVEGINQIVTGDLISLSEQQLVDCST-RNHGCEGGWPYRAFQYIINNGGINSEEHYPYTGTNGTCD-TKENAHVVSIDSYRNVPSNDEKSLQKAVANQPVSVTMDAAGRDFQLYRNGIFTGSCNISANH-YRTVGGRETENDKDYWTVKNSWGKNWGESGYIRVERNIAESSGKCGIAISPSYPIKE 218          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: ERVC_TABDI (Ervatamin-C OS=Tabernaemontana divaricata PE=1 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 5.409e-55
Identity = 112/197 (56.85%), Postives = 131/197 (66.50%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIK 606
            CGSCWAFST++ VE IN I T  L+SLSEQELVDCD  +N GC GG    A+++I   GG+ T+A YPY+A  G C  +   S  VSIDG+  VP  +E AL +AVA QP +VAIDA S+ FQ YS G+F+G CGT+LNHGV  VGY        YWIVRNSWG  WGEKGYIRM R      GLCGIA    YP K
Sbjct:   22 CGSCWAFSTVSTVESINQIRTGNLISLSEQELVDCDK-KNHGCLGGAFVFAYQYIINNGGIDTQANYPYKAVQGPCQAA---SKVVSIDGYNGVPFCNEXALKQAVAVQPSTVAIDASSAQFQQYSSGIFSGPCGTKLNHGVTIVGY-----QANYWIVRNSWGRYWGEKGYIRMLR--VGGCGLCGIARLPYYPTK 207          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: BROM1_ANACO (Fruit bromelain OS=Ananas comosus PE=1 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 5.409e-55
Identity = 104/202 (51.49%), Postives = 133/202 (65.84%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATN 621
            CGSCW+F+ IA VEGI  I T  LVSLSEQE++DC    + GC GG +  A++FI    GVTTE  YPY A  GTC+ +   + A  I G+  V  N E +++ AV+ QP++  IDA S +FQ+Y+ GVF+G CGT LNH +  +GYG    GTKYWIVRNSWG  WGE GY+RM RG+S   G+CGIAM   +P  +S  N
Sbjct:  144 CGSCWSFAAIATVEGIYKIKTGYLVSLSEQEVLDCAV--SYGCKGGWVNKAYDFIISNNGVTTEENYPYLAYQGTCNANSFPNSAY-ITGYSYVRRNDERSMMYAVSNQPIAALIDA-SENFQYYNGGVFSGPCGTSLNHAITIIGYGQDSSGTKYWIVRNSWGSSWGEGGYVRMARGVSSSSGVCGIAMAPLFPTLQSGAN 341          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: PAPA2_CARPA (Chymopapain OS=Carica papaya PE=1 SV=2)

HSP 1 Score: 212.231 bits (539), Expect = 2.684e-54
Identity = 101/197 (51.27%), Postives = 130/197 (65.99%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIK 606
            CGSCWAFSTIA VEGIN I+T  L+ LSEQELVDCD   + GC GG    + +++   G V T   YPYQA    C  + +  P V I G++ VP+N E + L A+A QP+SV ++AG   FQ Y  GVF G CGT+L+H V AVGYGT+ DG  Y I++NSWGP WGEKGY+R++R   + +G CG+   + YP K
Sbjct:  156 CGSCWAFSTIATVEGINKIVTGNLLELSEQELVDCDK-HSYGCKGGYQTTSLQYVANNG-VHTSKVYPYQAKQYKCRATDKPGPKVKITGYKRVPSNCETSFLGALANQPLSVLVEAGGKPFQLYKSGVFDGPCGTKLDHAVTAVGYGTS-DGKNYIIIKNSWGPNWGEKGYMRLKRQSGNSQGTCGVYKSSYYPFK 349          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: MEX1_JACME (Mexicain OS=Jacaratia mexicana PE=1 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 3.281e-52
Identity = 96/197 (48.73%), Postives = 131/197 (66.50%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIK 606
            CGSCWAFST+A +EGIN I+T +L+SLSEQEL+DC+  ++ GC+GG    + +++   G V TE +YPY+   G C    +  P V I G++ VPAN E +L++A+A QPVSV  D+    FQFY  G++ G CGT  +H V AVGYG T     Y +++NSWGP WGEKGYIR++R     KG CG+   + +PIK
Sbjct:   22 CGSCWAFSTVATIEGINKIITGQLISLSEQELLDCEY-RSHGCDGGYQTPSLQYVVDNG-VHTEREYPYEKKQGRCRAKDKKGPKVYITGYKYVPANDEISLIQAIANQPVSVVTDSRGRGFQFYKGGIYEGPCGTNTDHAVTAVGYGKT-----YLLLKNSWGPNWGEKGYIRIKRASGRSKGTCGVYTSSFFPIK 211          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: PAPA3_CARPA (Caricain OS=Carica papaya PE=1 SV=2)

HSP 1 Score: 201.445 bits (511), Expect = 4.738e-51
Identity = 97/197 (49.24%), Postives = 126/197 (63.96%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIK 606
            CGSCWAFS +A VEGIN I T KLV LSEQELVDC+  ++ GC GG    A E++ K G +   +KYPY+A  GTC   +   P V   G   V  N+E  LL A+AKQPVSV +++    FQ Y  G+F G CGT+++H V AVGYG +  G  Y +++NSWG  WGEKGYIR++R   +  G+CG+   + YP K
Sbjct:  154 CGSCWAFSAVATVEGINKIRTGKLVELSEQELVDCER-RSHGCKGGYPPYALEYVAKNG-IHLRSKYPYKAKQGTCRAKQVGGPIVKTSGVGRVQPNNEGNLLNAIAKQPVSVVVESKGRPFQLYKGGIFEGPCGTKVDHAVTAVGYGKS-GGKGYILIKNSWGTAWGEKGYIRIKRAPGNSPGVCGLYKSSYYPTK 347          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATL1_CHICK (Cathepsin L1 (Fragments) OS=Gallus gallus GN=CTSL1 PE=1 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 6.188e-51
Identity = 107/201 (53.23%), Postives = 133/201 (66.17%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGV-FTGECGTE-LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            +CGSCWAFST  A+EG +     KLVSLSEQ LVDC   + NQGCNGGLM+ AF++++  GG+ +E  YPY A D      K    A +  G  ++P  HE AL+KAVA   PVSVAIDAG S FQFY  G+ +  +C +E L+HGV  VGYG    G KYWIV+NSWG +WG+KGYI M +   D+K  CGIA  ASYP+
Sbjct:   21 QCGSCWAFSTTGALEGQHFRTKGKLVSLSEQNLVDCSRPEGNQGCNGGLMDQAFQYVQDNGGIDSEESYPYTAKDDEDCRYKAEYNAANDTGFVDIPQGHERALMKAVASVGPVSVAIDAGHSSFQFYQSGIYYEPDCSSEDLDHGVLVVGYGFE-GGKKYWIVKNSWGEKWGDKGYIYMAK---DRKNHCGIATAASYPL 217          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: PAPA4_CARPA (Papaya proteinase 4 OS=Carica papaya PE=1 SV=3)

HSP 1 Score: 200.675 bits (509), Expect = 8.082e-51
Identity = 96/197 (48.73%), Postives = 128/197 (64.97%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIK 606
            C SCWAFST+A VEGIN I T  LV LSEQELVDCD  Q+ GCN G    + +++ + G +   AKYPY A   TC  ++   P V  +G   V +N+E +LL A+A QPVSV +++   DFQ Y  G+F G CGT+++H V AVGYG +  G  Y +++NSWGP WGE GYIR++R   +  G+CG+   + YPIK
Sbjct:  154 CESCWAFSTVATVEGINKIKTGNLVELSEQELVDCDK-QSYGCNRGYQSTSLQYVAQNG-IHLRAKYPYIAKQQTCRANQVGGPKVKTNGVGRVQSNNEGSLLNAIAHQPVSVVVESAGRDFQNYKGGIFEGSCGTKVDHAVTAVGYGKS-GGKGYILIKNSWGPGWGENGYIRIRRASGNSPGVCGVYRSSYYPIK 347          
The following BLAST results are available for this feature:
BLAST of DC900201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 179
Match NameE-valueIdentityDescription
ACTN_ACTDE6.174e-5953.55Actinidain OS=Actinidia deliciosa PE=1 SV=1[more]
ACTN_ACTCH6.174e-5954.03Actinidain OS=Actinidia chinensis PE=1 SV=4[more]
CPGP1_ZINOF3.064e-5855.05Zingipain-1 OS=Zingiber officinale PE=1 SV=1[more]
ERVC_TABDI5.409e-5556.85Ervatamin-C OS=Tabernaemontana divaricata PE=1 SV=... [more]
BROM1_ANACO5.409e-5551.49Fruit bromelain OS=Ananas comosus PE=1 SV=1[more]
PAPA2_CARPA2.684e-5451.27Chymopapain OS=Carica papaya PE=1 SV=2[more]
MEX1_JACME3.281e-5248.73Mexicain OS=Jacaratia mexicana PE=1 SV=1[more]
PAPA3_CARPA4.738e-5149.24Caricain OS=Carica papaya PE=1 SV=2[more]
CATL1_CHICK6.188e-5153.23Cathepsin L1 (Fragments) OS=Gallus gallus GN=CTSL1... [more]
PAPA4_CARPA8.082e-5148.73Papaya proteinase 4 OS=Carica papaya PE=1 SV=3[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900201 VSS Citrus sinensis cDNA clone VS28238 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900201 ID=DC900201|Name=DC900201|organism=Citrus sinensis|type=EST|length=804bp
AATTCGGCACGAGAATGCGGTAGCTGCTGGGCTTTTTCAACAATTGCAGC
AGTAGAGGGCATTAATCACATTATGACAAATAAGCTCGTTTCTTTGTCTG
AGCAAGAGTTAGTTGATTGTGACACTGATCAAAACCAAGGATGTAATGGA
GGGCTAATGGAATTGGCATTTGAGTTCATCAAGAAAAAGGGTGGCGTAAC
AACAGAGGCTAAGTACCCTTACCAAGCTAATGATGGAACATGTGACGTTT
CAAAGGAAAGTTCCCCAGCAGTGTCAATTGACGGACATGAAAATGTACCT
GCTAATCACGAGGATGCTCTGCTTAAGGCAGTTGCAAAACAGCCTGTGTC
AGTAGCCATAGATGCCGGCAGTTCAGATTTCCAGTTCTATTCAGAGGGTG
TATTTACTGGAGAATGTGGCACAGAGCTGAATCATGGAGTTGCAGCTGTG
GGCTACGGTACAACACTCGATGGAACCAAGTATTGGATAGTGAGGAACTC
ATGGGGACCTGAATGGGGAGAGAAGGGTTACATCAGAATGCAGCGCGGCA
TCTCAGACAAAAAGGGACTCTGTGGTATTGCAATGGAAGCTTCATATCCC
ATCAAGAAATCTGCAACAAACCCAACAGGACCTTCAGATTATCCTAAGGA
TGAGCTCTAGACACGGTTCACTATTGTCTTTGGCTTTTCTCTGCATTTCA
AGCTCAGCGGTTATCTCTTCTGTGTTAAAGTTGCATGTAATATGCCCTTG
TGATTCATGATTGAATAATGTTTCGATTTATGCAAATAAAGCCAACATTT
TACA
back to top