DC900201

Overview
NameDC900201
Unique NameDC900201
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length804
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5643 contig Csv1_Contig5643:1..805. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSP5_DICDI (Cysteine proteinase 5 OS=Dictyostelium discoideum GN=cprE PE=2 SV=2)

HSP 1 Score: 178.718 bits (452), Expect = 3.289e-44
Identity = 95/217 (43.78%), Postives = 128/217 (58.99%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGV-FTGECGTE-LNHGVAAVGYG------------------TTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            +CG CW+FST  + EG +     +LVSLSEQ L+DC T+ N GC+GGLM  AFE+I    G+ TE+ YPY+A +G C+   E+S A ++  ++ V A  E +L  AV   PVSVAIDA    FQ Y+ G+ +  EC +E L+HGV AVGYG                  +     +YWIV+NSWG  WG +GYI M R   ++   CGIA  AS+P+
Sbjct:  132 QCGGCWSFSTTGSTEGAHFQSKGELVSLSEQNLIDCSTE-NSGCDGGLMTYAFEYIINNNGIDTESSYPYKAENGKCEYKSENSGA-TLSSYKTVTAGSESSLESAVNVNPVSVAIDASHQSFQLYTSGIYYEPECSSENLDHGVLAVGYGSGSGSSSGQSSGQSSGNLSASSSNEYWIVKNSWGTSWGIEGYILMSR---NRDNNCGIASSASFPV 343          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATK_PIG (Cathepsin K OS=Sus scrofa GN=CTSK PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 3.289e-44
Identity = 96/199 (48.24%), Postives = 126/199 (63.32%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGVFTGE-CGTE-LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS++ A+EG     T KL++LS Q LVDC   +N GC GG M  AF++++K  G+ +E  YPY   D  C +   +  A    G+  +P  +E AL +AVA+  PVSVAIDA  + FQFYS+GV+  E C ++ LNH V AVGYG    G K+WI++NSWG  WG KGYI M R   +K   CGIA  AS+P
Sbjct:  136 QCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDC-VSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQDENC-MYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDENCNSDNLNHAVLAVGYGIQ-KGKKHWIIKNSWGENWGNKGYILMAR---NKNNACGIANLASFP 328          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSP3_DICDI (Cysteine proteinase 3 OS=Dictyostelium discoideum GN=cprC PE=3 SV=2)

HSP 1 Score: 177.948 bits (450), Expect = 5.610e-44
Identity = 97/200 (48.50%), Postives = 127/200 (63.50%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTD-QNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGV-FTGECGTE-LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            +CGSC++FST  +VEG+  I T KLVSLSEQ ++DC +   N+GCNGGLM  AFE+I K  G+ +E +YPY+         +E S A  I  ++ + A  E+ L  A+   PVSVAIDA  + FQ Y+ GV +   C +E L+HGV AVG GT  +G  Y+IV+NSWGP WG  GYI M R   +K   CGI+  ASYPI
Sbjct:  141 QCGSCYSFSTTGSVEGVTAIKTGKLVSLSEQNILDCSSSFGNEGCNGGLMTNAFEYIIKNNGLNSEEQYPYEMKVNDECKFQEGSVAAKITSYKEIEAGDENDLQNALLLNPVSVAIDASHNSFQLYTAGVYYEPACSSEDLDHGVLAVGMGTD-NGEDYYIVKNSWGPSWGLNGYIHMAR---NKDNNCGISTMASYPI 336          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATK_MACMU (Cathepsin K OS=Macaca mulatta GN=CTSK PE=1 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 5.610e-44
Identity = 95/199 (47.74%), Postives = 127/199 (63.82%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGVFTGE-CGTE-LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS++ A+EG     T KL++LS Q LVDC   +N GC GG M  AF++++K  G+ +E  YPY   + +C +   +  A    G+  +P  +E AL +AVA+  PVSVAIDA  + FQFYS+GV+  E C ++ LNH V AVGYG    G K+WI++NSWG  WG KGYI M R   +K   CGIA  AS+P
Sbjct:  135 QCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDC-VSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESC-MYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQ-KGNKHWIIKNSWGENWGNKGYILMAR---NKNNACGIANLASFP 327          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATK_MACFA (Cathepsin K OS=Macaca fascicularis GN=CTSK PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 5.610e-44
Identity = 95/199 (47.74%), Postives = 127/199 (63.82%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGVFTGE-CGTE-LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS++ A+EG     T KL++LS Q LVDC   +N GC GG M  AF++++K  G+ +E  YPY   + +C +   +  A    G+  +P  +E AL +AVA+  PVSVAIDA  + FQFYS+GV+  E C ++ LNH V AVGYG    G K+WI++NSWG  WG KGYI M R   +K   CGIA  AS+P
Sbjct:  135 QCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDC-VSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESC-MYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQ-KGNKHWIIKNSWGENWGNKGYILMAR---NKNNACGIANLASFP 327          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATK_HUMAN (Cathepsin K OS=Homo sapiens GN=CTSK PE=1 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 5.610e-44
Identity = 95/199 (47.74%), Postives = 127/199 (63.82%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGVFTGE-CGTE-LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS++ A+EG     T KL++LS Q LVDC   +N GC GG M  AF++++K  G+ +E  YPY   + +C +   +  A    G+  +P  +E AL +AVA+  PVSVAIDA  + FQFYS+GV+  E C ++ LNH V AVGYG    G K+WI++NSWG  WG KGYI M R   +K   CGIA  AS+P
Sbjct:  135 QCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDC-VSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESC-MYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQ-KGNKHWIIKNSWGENWGNKGYILMAR---NKNNACGIANLASFP 327          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: BROM2_ANACO (Stem bromelain OS=Ananas comosus PE=1 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 7.327e-44
Identity = 93/195 (47.69%), Postives = 121/195 (62.05%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            CG+CWAF+ IA VE I  I    L  LSEQ+++DC   +  GC GG    AFEFI    GV + A YPY+A  GTC      + A  I G+  VP N+E +++ AV+KQP++VA+DA +++FQ+Y  GVF G CGT LNH V A+GYG   D   Y      WG +WGE GYIRM R +S   G+CGIA++  YP
Sbjct:   23 CGACWAFAAIATVESIYKIKKGILEPLSEQQVLDCA--KGYGCKGGWEFRAFEFIISNKGVASGAIYPYKAAKGTCKTDGVPNSAY-ITGYARVPRNNESSMMYAVSKQPITVAVDA-NANFQYYKSGVFNGPCGTSLNHAVTAIGYGQ--DSIIY---PKKWGAKWGEAGYIRMARDVSSSSGICGIAIDPLYP 208          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATK_RABIT (Cathepsin K OS=Oryctolagus cuniculus GN=CTSK PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.250e-43
Identity = 94/199 (47.24%), Postives = 127/199 (63.82%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGVFTGE-CGTE-LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS++ A+EG     T KL++LS Q LVDC   +N GC GG M  AF+++++  G+ +E  YPY   D +C +   +  A    G+  +P  +E AL +AVA+  PVSVAIDA  + FQFYS+GV+  E C ++ +NH V AVGYG    G K+WI++NSWG  WG KGYI M R   +K   CGIA  AS+P
Sbjct:  135 QCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDC-VSENYGCGGGYMTNAFQYVQRNRGIDSEDAYPYVGQDESC-MYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDENCSSDNVNHAVLAVGYGIQ-KGNKHWIIKNSWGESWGNKGYILMAR---NKNNACGIANLASFP 327          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATK_BOVIN (Cathepsin K OS=Bos taurus GN=CTSK PE=2 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 1.250e-43
Identity = 94/199 (47.24%), Postives = 125/199 (62.81%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGVFTGE-CGTE-LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS++ A+EG     T KL++LS Q LVDC   +N GC GG M  AF++++K  G+ +E  YPY   D  C +   +  A    G+  +P  +E AL +AVA+  P+SVAIDA  + FQFY +GV+  E C ++ LNH V AVGYG    G K+WI++NSWG  WG KGYI M R   +K   CGIA  AS+P
Sbjct:  135 QCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDC-VSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQDENC-MYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPISVAIDASLTSFQFYRKGVYYDENCNSDNLNHAVLAVGYGIQ-KGNKHWIIKNSWGENWGNKGYILMAR---NKNNACGIANLASFP 327          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATK_RAT (Cathepsin K OS=Rattus norvegicus GN=Ctsk PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.632e-43
Identity = 92/199 (46.23%), Postives = 125/199 (62.81%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQ-PVSVAIDAGSSDFQFYSEGVFTGE-CGTE-LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS+  A+EG     T KL++LS Q LVDC   +N GC GG M  AF+++++ GG+ +E  YPY   D +C +   ++ A    G+  +P  +E AL +AVA+  PVSV+IDA  + FQFYS GV+  E C  + +NH V  VGYGT   G KYWI++NSWG  WG KGY+ + R   +K   CGI   AS+P
Sbjct:  135 QCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDC-VSENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESC-MYNATAKAAKCRGYREIPVGNEKALKRAVARVGPVSVSIDASLTSFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQ-KGNKYWIIKNSWGESWGNKGYVLLAR---NKNNACGITNLASFP 327          
The following BLAST results are available for this feature:
BLAST of DC900201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 179
Match NameE-valueIdentityDescription
CYSP5_DICDI3.289e-4443.78Cysteine proteinase 5 OS=Dictyostelium discoideum ... [more]
CATK_PIG3.289e-4448.24Cathepsin K OS=Sus scrofa GN=CTSK PE=2 SV=1[more]
CYSP3_DICDI5.610e-4448.50Cysteine proteinase 3 OS=Dictyostelium discoideum ... [more]
CATK_MACMU5.610e-4447.74Cathepsin K OS=Macaca mulatta GN=CTSK PE=1 SV=1[more]
CATK_MACFA5.610e-4447.74Cathepsin K OS=Macaca fascicularis GN=CTSK PE=2 SV... [more]
CATK_HUMAN5.610e-4447.74Cathepsin K OS=Homo sapiens GN=CTSK PE=1 SV=1[more]
BROM2_ANACO7.327e-4447.69Stem bromelain OS=Ananas comosus PE=1 SV=1[more]
CATK_RABIT1.250e-4347.24Cathepsin K OS=Oryctolagus cuniculus GN=CTSK PE=1 ... [more]
CATK_BOVIN1.250e-4347.24Cathepsin K OS=Bos taurus GN=CTSK PE=2 SV=2[more]
CATK_RAT1.632e-4346.23Cathepsin K OS=Rattus norvegicus GN=Ctsk PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900201 VSS Citrus sinensis cDNA clone VS28238 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900201 ID=DC900201|Name=DC900201|organism=Citrus sinensis|type=EST|length=804bp
AATTCGGCACGAGAATGCGGTAGCTGCTGGGCTTTTTCAACAATTGCAGC
AGTAGAGGGCATTAATCACATTATGACAAATAAGCTCGTTTCTTTGTCTG
AGCAAGAGTTAGTTGATTGTGACACTGATCAAAACCAAGGATGTAATGGA
GGGCTAATGGAATTGGCATTTGAGTTCATCAAGAAAAAGGGTGGCGTAAC
AACAGAGGCTAAGTACCCTTACCAAGCTAATGATGGAACATGTGACGTTT
CAAAGGAAAGTTCCCCAGCAGTGTCAATTGACGGACATGAAAATGTACCT
GCTAATCACGAGGATGCTCTGCTTAAGGCAGTTGCAAAACAGCCTGTGTC
AGTAGCCATAGATGCCGGCAGTTCAGATTTCCAGTTCTATTCAGAGGGTG
TATTTACTGGAGAATGTGGCACAGAGCTGAATCATGGAGTTGCAGCTGTG
GGCTACGGTACAACACTCGATGGAACCAAGTATTGGATAGTGAGGAACTC
ATGGGGACCTGAATGGGGAGAGAAGGGTTACATCAGAATGCAGCGCGGCA
TCTCAGACAAAAAGGGACTCTGTGGTATTGCAATGGAAGCTTCATATCCC
ATCAAGAAATCTGCAACAAACCCAACAGGACCTTCAGATTATCCTAAGGA
TGAGCTCTAGACACGGTTCACTATTGTCTTTGGCTTTTCTCTGCATTTCA
AGCTCAGCGGTTATCTCTTCTGTGTTAAAGTTGCATGTAATATGCCCTTG
TGATTCATGATTGAATAATGTTTCGATTTATGCAAATAAAGCCAACATTT
TACA
back to top