DC900201

Overview
NameDC900201
Unique NameDC900201
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length804
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5643 contig Csv1_Contig5643:1..805. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATS_BOVIN (Cathepsin S OS=Bos taurus GN=CTSS PE=1 SV=2)

HSP 1 Score: 175.637 bits (444), Expect = 2.784e-43
Identity = 97/199 (48.74%), Postives = 122/199 (61.31%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ--NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGV-FTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            CGSCWAFS + A+E    + T KLVSLS Q LVDC T +  N+GCNGG M  AF++I    G+ +EA YPY+A DG C    ++  A +   +  +P   E+AL +AVA K PVSV IDA  S F  Y  GV +   C   +NHGV  VGYG  LDG  YW+V+NSWG  +G++GYIRM R   +    CGIA   SYP
Sbjct:  136 CGSCWAFSAVGALEAQVKLKTGKLVSLSAQNLVDCSTAKYGNKGCNGGFMTEAFQYIIDNNGIDSEASYPYKAMDGKCQYDVKNR-AATCSRYIELPFGSEEALKEAVANKGPVSVGIDASHSSFFLYKTGVYYDPSCTQNVNHGVLVVGYG-NLDGKDYWLVKNSWGLHFGDQGYIRMARNSGNH---CGIANYPSYP 329          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATS_CANFA (Cathepsin S OS=Canis familiaris GN=CTSS PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 6.203e-43
Identity = 95/199 (47.74%), Postives = 122/199 (61.31%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ--NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGV-FTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            CG+CWAFS + A+E    + T KLVSLS Q LVDC T++  N+GCNGG M  AF++I    G+ +EA YPY+A +G C    +   A +   +  +P   EDAL +AVA K PVSVAIDA    F  Y  GV +   C   +NHGV  VGYG  L+G  YW+V+NSWG  +G++GYIRM R   +    CGIA   SYP
Sbjct:  136 CGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNNGIDSEASYPYKAMNGKCRYDSKKR-AATCSKYTELPFGSEDALKEAVANKGPVSVAIDASHYSFFLYRSGVYYEPSCTQNVNHGVLVVGYG-NLNGKDYWLVKNSWGLNFGDQGYIRMARNSGNH---CGIASYPSYP 329          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: ALEU_ARATH (Thiol protease aleurain OS=Arabidopsis thaliana GN=ALEU PE=1 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 6.203e-43
Identity = 96/202 (47.52%), Postives = 121/202 (59.90%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDC-DTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGVFT-GECGT---ELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            CGSCW FST  A+E   H    K +SLSEQ+LVDC     N GCNGGL   AFE+IK  GG+ TE  YPY   D TC  S E +  V +    N+    ED L  AV   +PVS+A +   S F+ Y  GV+T   CG+   ++NH V AVGYG   DG  YW+++NSWG +WG+KGY +M+ G    K +CGIA  ASYP+
Sbjct:  162 CGSCWTFSTTGALEAAYHQAFGKGISLSEQQLVDCAGAFNNYGCNGGLPSQAFEYIKSNGGLDTEKAYPYTGKDETCKFSAE-NVGVQVLNSVNITLGAEDELKHAVGLVRPVSIAFEVIHS-FRLYKSGVYTDSHCGSTPMDVNHAVLAVGYGVE-DGVPYWLIKNSWGADWGDKGYFKMEMG----KNMCGIATCASYPV 356          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATK_MOUSE (Cathepsin K OS=Mus musculus GN=Ctsk PE=2 SV=2)

HSP 1 Score: 174.096 bits (440), Expect = 8.101e-43
Identity = 91/199 (45.73%), Postives = 126/199 (63.32%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGVFTGE-CGTE-LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS+  A+EG     T KL++LS Q LVDC T +N GC GG M  AF+++++ GG+ +E  YPY   D +C +   ++ A    G+  +P  +E AL +AVA+  P+SV+IDA  + FQFYS GV+  E C  + +NH V  VGYGT   G+K+WI++NSWG  WG KGY  + R   +K   CGI   AS+P
Sbjct:  135 QCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVT-ENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESC-MYNATAKAAKCRGYREIPVGNEKALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQ-KGSKHWIIKNSWGESWGNKGYALLAR---NKNNACGITNMASFP 327          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATK_CHICK (Cathepsin K OS=Gallus gallus GN=CTSK PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.382e-42
Identity = 95/199 (47.74%), Postives = 122/199 (61.31%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGVF--TGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS++ A+EG     T KL+SLS Q LV C    N GC GG M  AFE+++   G+ +E  YPY   D +C  S  +  A    G+  +P ++E AL +AVA+  PVSV IDA    FQFYS GV+  TG     +NH V AVGYG    GTK+WI++NSWG EWG KGY+ + R +   K  CGIA  AS+P
Sbjct:  140 QCGSCWAFSSVGALEGQLKRRTGKLLSLSPQNLVYC-VSNNNGCGGGYMTNAFEYVRLNRGIDSEDAYPYIGQDESCMYSP-TGKAAKCRGYREIPEDNEKALKRAVARIGPVSVGIDASLPSFQFYSRGVYYDTGCNPENINHAVLAVGYGAQ-KGTKHWIIKNSWGTEWGNKGYVLLARNM---KQTCGIANLASFP 332          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: PAPA1_CARPA (Papain OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 3.078e-42
Identity = 85/197 (43.15%), Postives = 116/197 (58.88%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIK 606
            CGSCWAFS +  +EGI  I T  L   SEQEL+DCD  ++ GCNGG    A + + + G +     YPY+     C   ++   A   DG   V   +E ALL ++A QPVSV ++A   DFQ Y  G+F G CG +++H VAAVGY     G  Y +++NSWG  WGE GYIR++RG  +  G+CG+   + YP+K
Sbjct:  155 CGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDR-RSYGCNGGYPWSALQLVAQYG-IHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGY-----GPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVK 344          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSP2_MAIZE (Cysteine proteinase 2 OS=Zea mays GN=CCP2 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 3.078e-42
Identity = 95/202 (47.03%), Postives = 122/202 (60.40%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCD-TDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGVFTGE-CGT---ELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            CGSCW FST  A+E      T K +SLSEQ+LVDC     N GCNGGL   AFE+IK  GG+ TE  YPYQ  +G C    E+     +D   N+    ED L  AV   +PVSVA +   + F+ Y  GV+T + CGT   ++NH V AVGYG   DG  YW+++NSWG +WG++GY +M+ G    K +CG+A  ASYPI
Sbjct:  164 CGSCWTFSTTGALEAAYTQATGKPISLSEQQLVDCGFAFNNFGCNGGLPSQAFEYIKYNGGLDTEESYPYQGVNGICKFKNENVGVKVLDS-VNITLGAEDELKDAVGLVRPVSVAFEV-ITGFRLYKSGVYTSDHCGTTPMDVNHAVLAVGYGVE-DGVPYWLIKNSWGADWGDEGYFKMEMG----KNMCGVATCASYPI 358          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSP1_HOMAM (Digestive cysteine proteinase 1 OS=Homarus americanus GN=LCP1 PE=1 SV=2)

HSP 1 Score: 171.014 bits (432), Expect = 6.858e-42
Identity = 92/201 (45.77%), Postives = 123/201 (61.19%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDC--DTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGV-FTGEC-GTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFST   +EG + + T +LVSLSEQ+LVDC   +  NQGCNGG +E A  +++  GGV TE+ YPY+A D TC  +  +  A +  G+  +    E AL  A     P+SVAIDA    FQ Y  GV +   C  ++L+H V AVGYG+   G  +W+V+NSW   WGE GYI+M R   ++   CGIA +A YP
Sbjct:  125 QCGSCWAFSTTGGIEGQHFLKTGRLVSLSEQQLVDCAGGSYYNQGCNGGWVERAIMYVRDNGGVDTESSYPYEARDNTCRFNSNTIGA-TCTGYVGIAQGSESALKTATRDIGPISVAIDASHRSFQSYYTGVYYEPSCSSSQLDHAVLAVGYGSE-GGQDFWLVKNSWATSWGESGYIKMAR---NRNNNCGIATDACYP 320          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSP2_DICDI (Cysteine proteinase 2 OS=Dictyostelium discoideum GN=cprB PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 8.957e-42
Identity = 97/236 (41.10%), Postives = 129/236 (54.66%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCD-TDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGV-FTGECG-TELNHGVAAVGYGT-------------------------------TLDGTK-----YWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            +CGSCW+FST  + EG + + T KLVSLSEQ LVDC   ++N GC+GGLM  AF++I K  G+ TE+ YPY A  G+  +  +S    +I G+ N+ A  E +L       PVSVAIDA  + FQ Y+ G+ +  +C  TEL+HGV  VGYG                                + D  +     YWIV+NSWG  WG KGYI M +   D+K  CGIA  +SYP+
Sbjct:  143 QCGSCWSFSTTGSTEGAHALKTKKLVSLSEQNLVDCSGPEENFGCDGGLMNNAFDYIIKNKGIDTESSYPYTAETGSTCLFNKSDIGATIKGYVNITAGSEISLENGAQHGPVSVAIDASHNSFQLYTSGIYYEPKCSPTELDHGVLVVGYGVQGKDDEGPVLNRKQTIVIHKNEDNKVESSDDSSDSVRPKANNYWIVKNSWGTSWGIKGYILMSK---DRKNNCGIASVSSYPL 375          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATS_HUMAN (Cathepsin S OS=Homo sapiens GN=CTSS PE=1 SV=3)

HSP 1 Score: 170.629 bits (431), Expect = 8.957e-42
Identity = 93/199 (46.73%), Postives = 121/199 (60.80%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ--NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGV-FTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            CG+CWAFS + A+E    + T KLVSLS Q LVDC T++  N+GCNGG M  AF++I    G+ ++A YPY+A D  C    +   A +   +  +P   ED L +AVA K PVSV +DA    F  Y  GV +   C   +NHGV  VGYG  L+G +YW+V+NSWG  +GE+GYIRM R   +K   CGIA   SYP
Sbjct:  136 CGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYR-AATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYG-DLNGKEYWLVKNSWGHNFGEEGYIRMAR---NKGNHCGIASFPSYP 329          
The following BLAST results are available for this feature:
BLAST of DC900201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 179
Match NameE-valueIdentityDescription
CATS_BOVIN2.784e-4348.74Cathepsin S OS=Bos taurus GN=CTSS PE=1 SV=2[more]
CATS_CANFA6.203e-4347.74Cathepsin S OS=Canis familiaris GN=CTSS PE=2 SV=1[more]
ALEU_ARATH6.203e-4347.52Thiol protease aleurain OS=Arabidopsis thaliana GN... [more]
CATK_MOUSE8.101e-4345.73Cathepsin K OS=Mus musculus GN=Ctsk PE=2 SV=2[more]
CATK_CHICK1.382e-4247.74Cathepsin K OS=Gallus gallus GN=CTSK PE=2 SV=1[more]
PAPA1_CARPA3.078e-4243.15Papain OS=Carica papaya PE=1 SV=1[more]
CYSP2_MAIZE3.078e-4247.03Cysteine proteinase 2 OS=Zea mays GN=CCP2 PE=2 SV=... [more]
CYSP1_HOMAM6.858e-4245.77Digestive cysteine proteinase 1 OS=Homarus america... [more]
CYSP2_DICDI8.957e-4241.10Cysteine proteinase 2 OS=Dictyostelium discoideum ... [more]
CATS_HUMAN8.957e-4246.73Cathepsin S OS=Homo sapiens GN=CTSS PE=1 SV=3[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900201 VSS Citrus sinensis cDNA clone VS28238 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900201 ID=DC900201|Name=DC900201|organism=Citrus sinensis|type=EST|length=804bp
AATTCGGCACGAGAATGCGGTAGCTGCTGGGCTTTTTCAACAATTGCAGC
AGTAGAGGGCATTAATCACATTATGACAAATAAGCTCGTTTCTTTGTCTG
AGCAAGAGTTAGTTGATTGTGACACTGATCAAAACCAAGGATGTAATGGA
GGGCTAATGGAATTGGCATTTGAGTTCATCAAGAAAAAGGGTGGCGTAAC
AACAGAGGCTAAGTACCCTTACCAAGCTAATGATGGAACATGTGACGTTT
CAAAGGAAAGTTCCCCAGCAGTGTCAATTGACGGACATGAAAATGTACCT
GCTAATCACGAGGATGCTCTGCTTAAGGCAGTTGCAAAACAGCCTGTGTC
AGTAGCCATAGATGCCGGCAGTTCAGATTTCCAGTTCTATTCAGAGGGTG
TATTTACTGGAGAATGTGGCACAGAGCTGAATCATGGAGTTGCAGCTGTG
GGCTACGGTACAACACTCGATGGAACCAAGTATTGGATAGTGAGGAACTC
ATGGGGACCTGAATGGGGAGAGAAGGGTTACATCAGAATGCAGCGCGGCA
TCTCAGACAAAAAGGGACTCTGTGGTATTGCAATGGAAGCTTCATATCCC
ATCAAGAAATCTGCAACAAACCCAACAGGACCTTCAGATTATCCTAAGGA
TGAGCTCTAGACACGGTTCACTATTGTCTTTGGCTTTTCTCTGCATTTCA
AGCTCAGCGGTTATCTCTTCTGTGTTAAAGTTGCATGTAATATGCCCTTG
TGATTCATGATTGAATAATGTTTCGATTTATGCAAATAAAGCCAACATTT
TACA
back to top